KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4968Help
Entry
SHJG_4968         CDS       T02063                                 

Definition
(GenBank) hypothetical protein
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00310  Lysine degradation
shy01100  Metabolic pathways
shy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    SHJG_4968
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     SHJG_4968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Lycopene_cycl Thi4 Pyr_redox_2 FAD_binding_2 Amino_oxidase Pyr_redox FAD_binding_3 HI0933_like FAD_oxidored Mqo Trp_halogenase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AEY90236
UniProt: H2JYS4
Position
5704692..5705909
Genome map
AA seq 405 aa AA seqDB search
MVQVRAGAYDCDVLVIGGGIVGLSTAYAITRAAPGTRVIVLEKEPGPARHQTGRNSGVIH
SGIYYRPDSLKARYAVRGAAEMVKFCAEYGIAHAVTGKLIVATERDELPRLHALVQRGRE
NGIPVRELGPAQITEYEPQVRGLAAIHVGTTGVCDFVGVAGELARASGAEIRYGARVVRV
DRRPERGVAVLTAAGDVVRARVLVNCAGLHCDEVARLTGDDPEVRIVPFRGEYYELARPE
LVRGLVYPVPDPAFPFLGVHLTRGIDGGVHIGPNAVPALAREGYDWGVVRPRELAGTVAW
PGSWAIARRHWRYGAGELRRSVSKGAFLEAVRRLLPAVEAGDLVRAPAGVRAQAVLRDGT
LVDDFLIREGARAVHVLNAPSPAATASLPIGREIGRRALAMLGSL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcaggtgcgggccggggcgtacgactgtgatgtgctcgtcatcggtggggggatc
gtcgggctgtcgaccgcgtatgcgatcacccgggccgcgcccggtacgcgcgtgatcgtg
ctggagaaggagccggggccggcccggcaccagacggggcgcaacagcggggtcatccac
agcgggatctactaccggccggactcgctcaaggcgcggtacgcggtgcggggcgccgcc
gagatggtgaagttctgcgccgagtacggcatcgcgcacgccgtcaccggcaagctgatc
gtcgccaccgagcgggacgagctgccacggctgcacgcgctggtgcagcgggggcgggag
aacggcatcccggtgcgggagctgggacccgcgcagatcaccgagtacgaacctcaggtg
cgcggcctcgccgccatacacgtcggtacgaccggggtgtgcgacttcgtgggcgtcgcg
ggcgagctggcgcgggcctccggggcggagatccgctacggcgcccgggtcgtgcgcgtg
gaccggcggccggagcggggcgtggccgtgctcaccgcggccggggacgtcgtacgcgcg
cgcgtgctggtgaactgcgccgggctgcactgcgacgaggtggcgcggctgaccggcgac
gaccccgaggtgcggatcgtgccgttccgcggggagtactacgagctggcgcggccggaa
ctggtgcgggggctggtgtacccggtgccggacccggcgttcccgttcctcggagtgcat
ctgacgcgcgggatcgacgggggcgtgcacatcgggcccaacgcggtgccggcgctcgcc
cgtgaggggtacgactggggggtcgtacggccccgggagctggccgggacggtcgcgtgg
ccggggtcctgggccatcgcccggcggcactggcggtacggcgccggcgagctgcgccgg
tcggtgtccaagggggcgttcctggaggccgtgcgaagactgctgcccgcggtggaggcc
ggggacctggtgcgggccccggccggggtgcgggcgcaggcggtgctgcgggacgggacg
ctggtggacgacttcctgatccgggagggggcgcgggcggtgcacgtgctgaacgcgccc
tcgccggcggccacggcttcgctgccgatcgggcgggagatcgggcgccgggcgctggcg
atgctcggctcgctgtag

DBGET integrated database retrieval system