KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5534Help
Entry
SHJG_5534         CDS       T02063                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00790  Folate biosynthesis
shy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SHJG_5534
Enzymes [BR:shy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SHJG_5534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: AEY90801
UniProt: H2JM68
Position
6324025..6324630
Genome map
AA seq 201 aa AA seqDB search
MTDPVTLDGEGPIGEFDEKRAENAVRELLIAVGEDPDREGLRETPARVARAYREIFAGLW
QQPEDVLTTTFDLGHDEMVLVKDIEVYSTCEHHLVPFRGVAHVGYIPSETGKITGLSKLA
RLVDVYARRPQVQERLTTQIADSLMNILEPRGVIVVVECEHMCMSMRGIRKPGAKTITSA
VRGQLRDAATRNEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggtgacgctggacggcgagggccccatcggcgagttcgacgagaagcgc
gccgagaacgccgttcgcgaactgctgatcgcggtcggcgaggacccggaccgcgagggc
ctgcgggagacgccggccagggtcgcgcgtgcctacagggagatcttcgccggtctgtgg
cagcagcccgaggacgtcctgacgacgacgttcgacctggggcacgacgagatggtcctg
gtgaaggacatcgaggtgtactcgacctgcgagcatcatctggtgccgttccggggtgtc
gctcacgtcggctacatcccgtccgagaccggcaagatcaccggcctgtccaagctggcc
cgcctggtcgacgtctacgcccgccggccgcaggtgcaggagcgcctcaccacgcagatc
gcggactccctgatgaacatcctggagccgcggggcgtcatcgtggtcgtcgagtgcgag
cacatgtgcatgtccatgcggggcatccgcaagccgggcgcgaagaccataacgtccgcg
gtccgcggtcagctgcgggacgcggcgacgcggaacgaggcgatgagcctcatcatggcg
cgctga

DBGET integrated database retrieval system