KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5910Help
Entry
SHJG_5910         CDS       T02063                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00020  Citrate cycle (TCA cycle)
shy00640  Propanoate metabolism
shy00660  C5-Branched dibasic acid metabolism
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01130  Biosynthesis of antibiotics
shy01200  Carbon metabolism
Module
shy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SHJG_5910
   00640 Propanoate metabolism
    SHJG_5910
   00660 C5-Branched dibasic acid metabolism
    SHJG_5910
Enzymes [BR:shy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SHJG_5910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF585
Motif
Other DBs
NCBI-ProteinID: AEY91177
UniProt: H2JUI5
Position
6726774..6727952
Genome map
AA seq 392 aa AA seqDB search
MDLFEYQARDLFAKHDVPVLAGEVIDTPEAAREITERLGGKSVVKAQVKVGGRGKAGGVK
LAASPDEAVARATDILGMDIKGHTVHKVMIAETAPEIVEEYYVSFLLDRANRTFLSIASV
EGGMEIEEVAATRPEAVAKTPIDPIDGVDEAKAREIVEAAKFPAEVADKVVNVLIKLWDT
FLKSDALLVEVNPLAKVASGEVIALDGKVSLDDNAEFRHPEYEALHDKAAANPLEAAAKE
KNLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAQVMANGL
EIILGDPDVKSVFVNVFGGITACDEVANGIVQALKLLEDRGEKVEKPLVVRLDGNNAELG
RKILTDANHPLVQRVDTMDGAADKAAELAAAK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcgagggacctcttcgccaagcacgatgtaccggtgctg
gccggtgaagtcatcgacacgcctgaggcggcgcgcgagatcaccgagcggctcggcggc
aagtccgtcgtcaaggcgcaggtgaaggtcggtggtcgcggcaaggccggcggcgtcaag
ctggccgcctccccggacgaggccgtcgcccgcgcgacggacatcctcggcatggacatc
aagggccacacggtccacaaggtcatgatcgccgagaccgctccggagatcgtcgaggag
tactacgtctccttcctcctcgaccgtgccaaccgcaccttcctgtccatcgcgtccgtc
gagggcggcatggagatcgaggaggtggcggccacccgtccggaggccgtcgccaagacc
ccgatcgacccgatcgacggtgtggacgaggccaaggcccgcgagatcgtggaggccgcc
aagttcccggccgaggtcgcggacaaggtcgtcaacgtcctgatcaagctgtgggacacc
ttcctcaagtcggacgccctcctcgtcgaggtcaacccgctcgcgaaggtcgcctccggt
gaggtcatcgcgctcgacggcaaggtgtcgctcgacgacaacgccgagttccgtcacccc
gagtacgaggcgctccacgacaaggccgcggccaacccgctggaggccgccgccaaggag
aagaacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggcgccggt
ctcgtcatgagcaccctggacgtcgtcgcgtacgccggtgagaagcacggtggcgtcaag
cccgccaacttcctggacatcggcggcggtgcctccgcccaggtgatggcgaacggcctg
gagatcatcctgggcgacccggacgtcaagtccgtcttcgtgaacgtcttcggtggcatc
accgcctgcgacgaggtcgccaacggcatcgtgcaggccctgaagctcctggaggaccgc
ggcgagaaggtcgagaagccgctcgtcgtccgcctcgacggcaacaacgccgagctgggc
cggaagatcctcacggacgccaaccacccgctggtgcagcgcgtcgacaccatggacggc
gcggccgacaaggccgccgagctggccgccgccaagtaa

DBGET integrated database retrieval system