KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6363Help
Entry
SHJG_6363         CDS       T02063                                 

Definition
(GenBank) polyprenyl synthetase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00900  Terpenoid backbone biosynthesis
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01130  Biosynthesis of antibiotics
Module
shy_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SHJG_6363
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:shy01006]
    SHJG_6363
Enzymes [BR:shy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SHJG_6363
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SHJG_6363
    2.5.1.29  geranylgeranyl diphosphate synthase
     SHJG_6363
Prenyltransferases [BR:shy01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SHJG_6363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AEY91630
UniProt: H2K3T4
Position
7237536..7238681
Genome map
AA seq 381 aa AA seqDB search
MAEFMTETEARSSGVPRPGTPGEPPEKAGDGAAGPLDGHEAAAQLERARALVDPELRAAV
ESLPGSMRRIASYHFGWQHADGTPAAGNAGKAIRPALVLAAAAALGGPAARAAAVPAAAA
VELVHNFTLLHDDVMDRDATRRHRPTAWTVFGDADAILAGDALQALALRLLAEAPHPASV
PAAARLAACVVELCEGQHADTDLERCAPDAVTLDEVLAMAEAKTGALLGCACALGALYAG
AGEEEVAALDGFGRQAGLAFQLIDDVIGIWGDPRHTGKPAGADLAARKKSLPVVAALTSG
TPAAAELAALYGTPYREEEAEAGELARTALAVERAGGRDWAQAEAADRMARAMQELARAV
PDPEAAGGLLALAEFVTRRTN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcatgacggagaccgaagcgcgttcctccggtgtgccgcgtcccggcaca
ccgggggagccgcccgagaaggccggggacggcgccgccggtccgctcgacggacacgag
gcggcggcccaactggagcgcgcccgggcactggtcgacccggagctgcgcgcggccgtg
gagtcgctgcccggttccatgcgccggatcgcgagctaccacttcggctggcagcacgcc
gacggcaccccggcggcgggcaacgcgggcaaggcgatcagacccgcgctcgtgctggcg
gctgccgccgcgctcggtggcccggcggcccgggcggcggccgtcccggcggcagcggcg
gtcgaactggtccacaacttcacgctgttgcacgacgacgtgatggaccgggacgccacc
cgccgccaccggccgacggcctggaccgtgttcggcgacgccgacgcaatcctcgccggg
gacgccctccaggcgctggccctgcggctgctcgccgaggctccgcacccggcctccgtg
ccggccgcggcccggctcgcggcctgtgtcgtggaactgtgcgagggccagcacgccgac
accgacctggagcggtgcgcgccggacgcggtcaccctggacgaggtgctcgcgatggcc
gaggccaagaccggcgccctgctgggctgtgcctgcgcgctcggcgcgctgtacgcgggc
gcgggcgaggaggaggtggccgcgctcgacggcttcggccggcaggccgggctcgccttc
cagctcatcgacgacgtcatcggcatatggggggaccctcggcacaccggcaagccggcc
ggcgcggatctcgccgcccgcaagaagtccctgccggtggtggcggcgctcacctccggc
accccggcggcggccgagctcgccgcgctgtacgggacgccgtaccgcgaggaggaggcg
gaggccggggagctcgcgcgtacggcgctggcggtggaacgggcgggcggccgggactgg
gcgcaggccgaggcggccgaccggatggcccgggccatgcaggagctggcccgagcggtc
cccgatccggaggcggcgggcggtctgctggcgctcgccgagttcgtgacccggcgcacc
aactga

DBGET integrated database retrieval system