KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6783Help
Entry
SHJG_6783         CDS       T02063                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00900  Terpenoid backbone biosynthesis
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01130  Biosynthesis of antibiotics
Module
shy_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SHJG_6783
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SHJG_6783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEY92050
UniProt: H2JZ40
Position
7710729..7712000
Genome map
AA seq 423 aa AA seqDB search
MTDSPARPAPLADPHLVYDPAPGDGPKDVVILGSTGSIGTQAIDLVLRNPDRFRVTALSA
NGGRVALLAEQAHRLRVRTVAVAREDVVPALREALAAEYGGAEPLPEILAGPDAATQVAA
SACHTVLNGITGSIGLAPTLAALEAGRTLALANKESLIVGGPLVTALAKPGQIIPVDSEH
AALFQALAAGTRADVRKLVVTASGGPFRGRTRDELAHVTVADALAHPTWAMGPVITVNSA
TLVNKGLEVIEAHLLYDIPFDRIEVVVHPQSYVHSMVEFTDGSTIAQATPPDMRGPIAIG
LGWPERVPDAAPAFDWSKASTWEFFPLDDEAFPSVDLARHVGRLAGTAPAVFNAANEECV
AAFLSGALPFNGIMDTVTRVVEEHGTPVTGTSLTVSDVLEAETWARARARELTATTATAE
ARA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacagtcccgcccgtccggcccccctcgccgacccgcacctcgtctacgacccc
gcccccggggacggccccaaggacgtggtgatcctcggctccaccggatccatcggcacc
caggccatcgacctcgtgctgcgcaaccccgaccgcttccgggtcaccgccctgtccgcg
aacggcggccgggtggccctcctcgccgagcaggcgcaccggctgcgggtgcggaccgtg
gcggtcgcccgcgaggacgtcgtccccgcgctgcgcgaggcgctcgccgccgagtacggc
ggcgccgagccgctgcccgagatcctcgccggacccgacgcggccacccaggtcgccgcc
tccgcgtgccacaccgtgctcaacggcatcaccggctccatcggcctcgccccgaccctc
gccgccctggaggcgggccgcaccctcgcgctcgccaacaaggagtcgctgatcgtcggc
ggcccgctggtcaccgcgctcgcgaagccggggcagatcatcccggtggactccgagcac
gcggccctcttccaggcgctcgccgccggtacccgggccgacgtccgcaagctcgtcgtc
accgcctccggcggccccttccgcggccggaccagggacgaactggcacacgtcaccgtc
gcggacgccctcgcccaccccacgtgggcgatgggcccggtcatcacggtcaactcagcg
accctggtcaacaagggactggaggtcatcgaggcccacctcctctacgacattcccttc
gaccgcattgaggtggtcgtgcacccgcagtcgtatgtccactcgatggtcgagttcacc
gacggatccacgatcgcccaggcgacgccccccgacatgcgcgggcccatcgccatcgga
ctgggctggcccgaacgtgtcccggacgcggcccccgcgttcgactggagcaaggcctcc
acctgggagttcttcccgctggacgacgaggccttcccctcggtggacctcgcccggcac
gtggggcggctcgcgggcacggccccggcggtgttcaatgccgccaacgaggagtgcgtc
gcggccttcctgagcggcgcgctgcccttcaacgggatcatggataccgtcacccgggtg
gtggaggagcacggcaccccggtcacgggaacctcactcacggtgtcggacgtcctcgaa
gcggagacctgggcaagagcccgggcccgcgaactcacagccacgacggcgaccgcggag
gcgcgtgcatga

DBGET integrated database retrieval system