KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6984Help
Entry
SHJG_6984         CDS       T02063                                 

Definition
(GenBank) endo-1,4-beta-xylanase
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Brite
Enzymes [BR:shy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SHJG_6984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_10 Ricin_B_lectin RicinB_lectin_2 CDtoxinA
Motif
Other DBs
NCBI-ProteinID: AEY92251
UniProt: H2K2E3
Position
complement(7957252..7958685)
Genome map
AA seq 477 aa AA seqDB search
MGSYALPRSGIRRKIHGLLLTLVVGVLGTVTALVAPPTAHAAESTLGAAAAQSGRYFGTA
IASGKLGDSAYTTIASREFNMVTAENEMKIDATEPQRGQFNFSAGDRVYNWAVQNGKQVR
GHTLAWHSQQPGWMQSLSGSTLRQAMIDHINGVMGHYKGKIAQWDVVNEAFSDDGSGGRR
DSNLQRTGNDWIEVAFRTARAADPAAKLCYNDYNIENWTWAKTQGVYNMVRDFKQRGVPI
DCVGFQSHFNSGSPYNSNFRTTLQNFAALGVDVAITELDIQGASSSTYAAVTNDCLAVSR
CLGITVWGVRDTDSWRSGDTPLLFNGDGSKKAAYTAVLNALNGGSSTPPPSGGGQIKGVG
SGRCLDVPNASTTDGTQVQLYDCHSATNQQWTYTDAGELRVYGDKCLDAAGTGNGTKVQI
YSCWGGDNQKWRLNSDGSIVGVQSGLCLDAVGGGTANGTLIQLYSCSNGSNQRWTRT
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgtacgcccttcccagatccggtatccgccggaagatccacggcctgctgctg
acgctggtcgtcggcgtcctcggcacggtcaccgcactggtggcgccgccgaccgcacac
gccgccgagagcacgctcggcgccgcggcggcacagagcggccgctacttcggcaccgcc
atcgcctcgggcaagcttggcgactcggcgtacacgacgatcgcgagccgtgagttcaac
atggtgacggccgagaacgagatgaagatcgacgccaccgaaccgcagcggggccagttc
aacttctccgccggtgaccgcgtctacaactgggcggtgcagaacggcaagcaggtgcgc
ggccacaccctggcctggcactcccagcagcccggctggatgcagagcctcagcggcagc
acactgcgccaggcgatgatcgaccacatcaacggcgtgatgggccactacaagggcaag
atcgcccagtgggacgtcgtgaacgaggccttctcggacgacggttcgggcggccgccgg
gattccaacctgcagcgcaccggcaacgactggatcgaggtcgccttccggaccgcgcgc
gccgccgacccggcggccaagctctgctacaacgactacaacatcgagaactggacctgg
gcgaagacccagggcgtgtacaacatggtccgcgacttcaagcagcgcggcgtgccgatc
gactgcgtcggcttccagtcgcacttcaacagcggcagcccctacaacagcaacttccgc
accaccctccagaacttcgccgccctcggcgtcgacgtggccatcaccgaactcgacatc
cagggcgcgtcgtcctcgacctacgccgccgtgaccaacgactgcctggccgtctcgcgc
tgcctgggcatcaccgtctggggcgtgcgcgacaccgactcctggcgatcgggggacacg
ccgctgctgttcaacggcgacggcagcaagaaggctgcctacaccgccgtcctcaacgca
ctcaacggcggctcctccacgccgccgccttcgggtggcggacagatcaagggcgtcggt
tcgggccgttgcctggacgtgcccaacgccagcaccaccgacggcacccaggttcagttg
tacgactgccacagcgccaccaaccagcagtggacgtacaccgacgccggcgagctcagg
gtctacggcgacaagtgcctggacgccgccggcaccggcaacggcaccaaggtccagatc
tacagctgctggggcggcgacaaccagaagtggcgcctcaactccgacggatccatcgtc
ggcgtccagtccggcctctgcctcgacgccgtcggaggcggaaccgccaacggcaccctg
atccagctctactcctgctccaacggcagcaaccaacgctggacccgcacctga

DBGET integrated database retrieval system