KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7528Help
Entry
SHJG_7528         CDS       T02063                                 

Definition
(GenBank) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00020  Citrate cycle (TCA cycle)
shy00640  Propanoate metabolism
shy00660  C5-Branched dibasic acid metabolism
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01130  Biosynthesis of antibiotics
shy01200  Carbon metabolism
Module
shy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SHJG_7528
   00640 Propanoate metabolism
    SHJG_7528
   00660 C5-Branched dibasic acid metabolism
    SHJG_7528
Enzymes [BR:shy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SHJG_7528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AEY92795
UniProt: H2JP11
Position
8567858..8568739
Genome map
AA seq 293 aa AA seqDB search
MAIHLTTESRILVQGMTGAEGMKHTRRMLAAGTNVVGGVNPRKAGRTVDVDGHPLPVFGS
VADGMRATGADVSVVFVPPAFAKAAVTEAADARIPLAVVITEGIPVHDTVAFTAYARQRG
TRIIGPNCPGLISPGQSNAGIIPADIAQPGRIGLVSKSGTLTYQLMYELRDTGFSTCVGI
GGDPVVGTSHIDCLAAFQDDPDTELIVLIGEIGGDAEERAAAYVRDHVTKPVVGYIAGFT
APEGRTMGHAGAIVSGSTGTARAKQEALEAAGVRVGRTPTETARAVLETLRKG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggccatccacctcaccacggagagcaggatcctcgtccagggcatgaccggcgccgag
ggcatgaagcacacccggcggatgctcgcggccggcacgaacgtcgtcggcggggtcaac
ccgcgcaaggccggccgtaccgtcgacgtcgacgggcacccgctgcccgtcttcggctcg
gtcgccgacggcatgcgcgcgaccggcgccgacgtcagcgtcgtcttcgtcccgccggcc
ttcgccaaggcggccgtcaccgaggccgccgacgcccggatcccgctggccgtcgtcatc
accgagggcatcccggtccacgacaccgtcgccttcaccgcgtacgcgcggcagcggggc
acgcggatcatcggacccaactgccccggcctgatctccccgggccagtcgaacgcgggc
atcatccccgccgacatcgcccagcccggccgtatcggcctggtctccaaatcgggcacc
ctcacctaccagctcatgtacgagctgcgcgacaccggcttctccacctgtgtcggcatc
ggcggcgaccccgtcgtcggcaccagccacatcgactgcctggccgcgttccaggacgac
cccgacaccgaactgatcgtcctgatcggggagatcggcggcgacgcggaggaacgggcg
gccgcctacgtccgcgaccacgtcaccaagcccgtcgtcggctacatcgccgggttcacc
gcgcccgagggccggaccatgggccacgccggcgccatcgtctccggctccaccggcacc
gcccgcgccaagcaggaggccctggaggcggccggggtgcgggtgggccgcacccccacg
gagacggcccgggcggtgctggagacgctgcggaagggctga

DBGET integrated database retrieval system