KEGG   Sphingobium hydrophobicum: CJD35_03670Help
Entry
CJD35_03670       CDS       T05146                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
shyd  Sphingobium hydrophobicum
Pathway
shyd00260  Glycine, serine and threonine metabolism
shyd01100  Metabolic pathways
shyd01110  Biosynthesis of secondary metabolites
shyd01120  Microbial metabolism in diverse environments
shyd01130  Biosynthesis of antibiotics
shyd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shyd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJD35_03670
Enzymes [BR:shyd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CJD35_03670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ASY43653
UniProt: A0A249MQM4
Position
I:746387..747406
Genome map
AA seq 339 aa AA seqDB search
MHFFSDNATPLCPQVMAAIAAADLADHGYDGDQWSARLDDAFSALFDTRVRALWIATGTA
ANSIALATLCPPYGGVICHEEAHIVVDECGAPGFFTHGASLMALPGEGAKLHPDMVSARL
AAIRPDVHQVPARAISITNATEYGRAYTPDEVAALGDIARTHGLGFHMDGARFANVVAHL
GCAPADLTWRAGVNALSFGCVKNGGMIGEALLFFGPQADARAAEAARWRKRSGHLFSKGR
YLAAQILAMVEGDLWLANARAANAAAQALAQAVPARLLHRVEANELFIRLTAADAAALRA
QGFDFYDWGEGAARLVTNWSQDAASVAPLAAALRTLDHG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcactttttttccgacaatgcgaccccgctatgcccgcaggtgatggcggcgatagcc
gctgccgatctggccgatcatggctatgatggcgaccagtggagcgcccggctggatgac
gctttctcggccctgttcgacacgcgcgtccgggcactgtggatcgcgaccggcacggcc
gccaacagcatcgcgctggcaacgctctgcccgccctatggcggcgtgatctgccatgaa
gaagcgcatatcgtcgtcgacgaatgcggcgcgcccggattcttcacccatggcgcgagc
ctcatggctttgcccggcgagggcgcgaaacttcatcccgacatggtcagcgcgcggctc
gcggcgatccgcccggacgtgcatcaggtgccagcccgcgcgatcagcatcaccaacgcc
actgaatatggccgcgcctacacgcccgacgaggtcgcagcgctgggcgacatcgcgcgc
acccacggcctgggcttccatatggatggcgcgcgttttgccaatgtggtggcgcatctg
ggctgcgcgcccgccgatctgacatggcgcgccggcgtcaacgcgctcagctttggctgc
gtcaagaatggcgggatgatcggcgaggcattgctctttttcggcccgcaggcagacgcc
cgcgccgccgaggctgcccgctggcgcaagcggtcggggcatctattctccaagggccgc
tatcttgccgcgcagattttggcgatggtcgaaggcgacctgtggctggccaacgcccgc
gccgccaatgccgcagcgcaggcgctggcgcaggccgtgcccgcccgcctgctccaccgc
gtcgaagcgaatgaactgttcatccgcctcaccgccgccgatgcagcggcgctgcgggcg
cagggtttcgacttttacgactggggcgaaggggccgcgcggctggtcaccaactggtca
caggacgccgccagcgtcgcgccgctcgccgccgcgttgcggacactcgaccatggctga

DBGET integrated database retrieval system