KEGG   Sphingobium hydrophobicum: CJD35_07370Help
Entry
CJD35_07370       CDS       T05146                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
shyd  Sphingobium hydrophobicum
Pathway
shyd00360  Phenylalanine metabolism
shyd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shyd00790  Folate biosynthesis
shyd01100  Metabolic pathways
shyd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shyd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CJD35_07370
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJD35_07370
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CJD35_07370
Enzymes [BR:shyd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CJD35_07370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ASY44283
UniProt: A0A249MSF1
Position
I:1511165..1512052
Genome map
AA seq 295 aa AA seqDB search
MAETPHAETPLDRPAHAAEDWTVPQDWDRYSAADHAMWDRLFERQARMLPGRVVPEFMAG
LDILRMDQPGIPRFDALSDRLMQATGWQVVAVPGLVPDRLFFDHLANRRFPAGRFIRTPS
QEDYLEEPDVFHDVFGHVPLLANPVFADYMQAYGQGGLRADGLGAIEKLARLYWYTVEFG
LIDTDEGLRLYGAGIVSSNAESHFALEDASPNRLGFDLQRLMRTRYKIDDFQQSYFVIDS
FDQLLRQTVETDFAPLYAALAQQSDLDTDTILPDDRVFTRGTQAYAHKKMQEEPK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccccgcacgccgaaaccccgctcgaccgtcccgcgcacgccgcggaggac
tggaccgttccgcaggactgggatcgctacagcgcggccgaccatgcgatgtgggaccgg
ctgttcgagcggcaggcgcgcatgttgccggggcgggtggtgccggaattcatggcgggg
ctggacatattgcggatggaccagccgggcatcccgcgtttcgacgcgctgtccgaccga
ttgatgcaggcgaccgggtggcaggtggtggcagtgccggggctggtgcccgaccggctg
tttttcgatcatctggccaatcgccgctttcccgccgggcgcttcatccgcacgccaagc
caggaggattatctggaggagccggacgtgtttcacgacgtgttcggccatgttcccctg
ctcgccaatccggtgttcgccgattatatgcaggcctatggccagggcgggttgcgcgcc
gacgggttgggcgcgatcgagaagctggcgcggctttactggtacaccgtcgaattcggg
ctgatcgacacggacgagggtctgcgcctctatggcgcggggatcgtgtcgtccaatgcc
gaatcgcatttcgcgctggaggatgcctcccccaaccggctgggcttcgatcttcagcgg
ctgatgcggacccgttataaaatcgacgatttccagcagagctatttcgtcatcgacagt
ttcgatcagctgttgcgccagaccgtcgagaccgatttcgcgccgctctatgccgcgctg
gcgcagcaaagcgatctcgataccgacaccatcctgccagacgaccgggtctttacccgc
gggacgcaggcctatgcccataagaaaatgcaagaggagccgaaatga

DBGET integrated database retrieval system