KEGG   Sphingobium hydrophobicum: CJD35_10530Help
Entry
CJD35_10530       CDS       T05146                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
shyd  Sphingobium hydrophobicum
Pathway
shyd00780  Biotin metabolism
shyd01100  Metabolic pathways
Module
shyd_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:shyd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CJD35_10530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shyd01007]
    CJD35_10530
Enzymes [BR:shyd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CJD35_10530
Amino acid related enzymes [BR:shyd01007]
 Aminotransferase (transaminase)
  Class II
   CJD35_10530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ASY44839
UniProt: A0A249MUM5
Position
I:complement(2134163..2135389)
Genome map
AA seq 408 aa AA seqDB search
MTDTATETRDLLSKFDPLIAERQALLDTGVRDPFSIVMDQVLSPTRAIIKGKETILLGTY
NYMGMTFDPDVVAAGKKALDEFGAGTTGSRVLNGTYQGHREVEDALKEFYGTSSAMVFST
GYQANLGMISTLAGRGDYVVLDADSHASIYDGCFLGDAEIVRFRHNSVEDLDKRLGRLPA
DALKLVVLEGVYSMLGDIAPLPDMVAAVRKHQNCMILVDEAHGMGFFGPNGRGVYEEQGV
EQDVDFVVGTFSKSVGTVGGFCVSNHPKFEIMRLVCRPYVFTASLPPSVVATAATSIRKL
MHAGEKRAHLWKNSKRLHQGLTDLGFTLGTTTPQSAIIAVILTDQAQAVAIWQTLLELGL
YVNMARPPATPAGTFLLRCSLCADHSDEQVEQIIGMFKAAGQATGAIA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccgccactgaaacccgcgatctgctgtccaaattcgatcccctgatcgcc
gagcggcaggcgctgctcgacaccggcgtgcgcgatcctttctcgatcgtgatggatcag
gtgctttctcccacgcgcgcgatcatcaagggcaaggaaaccatcctgctgggcacctat
aattatatgggcatgaccttcgacccggacgtggtcgcggcgggcaagaaagcgctggac
gaatttggcgctggcacgaccggcagccgcgtcctcaacggcacctatcagggccatcgc
gaagtcgaggacgcgctcaaggaattttacggcacatcgtccgccatggtcttttcgacc
ggctatcaggccaatctgggcatgatttcgacgctggccggacgcggcgactatgtcgtg
ctggacgctgacagccatgcgtccatctatgatggctgcttcctgggcgacgcggaaatc
gtccgcttccgccacaacagcgtcgaggatctggacaagcgcctgggtcgcctgcccgcc
gacgcgctcaagctggtcgtgctggaaggcgtctattcgatgctgggcgacatcgccccc
ctgcccgacatggtggccgcggtgcgcaagcatcaaaattgcatgatcctggtcgatgaa
gcgcatggcatgggctttttcggtcccaatggccggggcgtctatgaggaacagggcgtc
gaacaagacgtggatttcgtcgtcggcaccttttccaaatcggtcggcacggtcggcggc
ttctgcgtttccaaccatcccaagtttgagatcatgcggctggtctgccgtccctatgtg
ttcaccgcatcgctgccgcccagcgtggtcgcgaccgccgcgacctccatccgcaagctg
atgcatgcgggtgaaaagcgcgcccacttgtggaagaacagcaagcggctgcatcaggga
ctgaccgaccttggcttcaccctgggcaccacgacgccgcaatcggcaatcatcgcagtg
atcctgaccgatcaggcgcaggccgtggcgatctggcagacgctgctggaactgggcctc
tacgtcaacatggcgcgcccgcccgcaaccccggccggcaccttcctgctgcgctgctcg
ctatgtgccgatcatagcgacgaacaggtcgaacagattatcggcatgttcaaggccgcg
ggtcaggcgaccggcgcgatcgcctga

DBGET integrated database retrieval system