KEGG   Sphingobium hydrophobicum: CJD35_21310Help
Entry
CJD35_21310       CDS       T05146                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
shyd  Sphingobium hydrophobicum
Pathway
shyd00625  Chloroalkane and chloroalkene degradation
shyd00680  Methane metabolism
shyd01100  Metabolic pathways
shyd01120  Microbial metabolism in diverse environments
shyd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shyd00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    CJD35_21310
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CJD35_21310
Enzymes [BR:shyd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     CJD35_21310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C HI0933_like AlaDh_PNT_C FAD_binding_3 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ASY47004
UniProt: A0A249MZ82
Position
p3:112954..114093
Genome map
AA seq 379 aa AA seqDB search
MKAIVYNGPKDVSVNTIDDPKIEKPTDVIIRLTTTNICGSDLHMYEGRTSFEKGRVFGHE
NLGEVIEVGAAVDRIKKGDRVCMPFNVGCGFCENCERGLTGFCLTTNPGTAGAAYGFAEM
GPWQGGQAELMRIPYADFNCLKLPEDAEEKEDDYVMLSDIFPTGWHGVELSGFLPGESIA
IYGAGPVGLMAAHSAEIRGASQIFVVDSHDDRLKLAEAMGAIPIDMRKGDPAQQILDATG
GLGTDRGVEAVGYQCCDRHGKERSNYTMNCLVKSTKATGGIGVVGVFIPEDPNAPDDLQK
EGKMAFDFGNFWFKGQKIGTGQCNVKHYNRRLMKLIEQDRANPAQIISHRLPLDQAPDAY
KHFDERDAGWTKVVLKPGT
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctatcgtgtacaacgggcccaaagacgtttccgtcaataccatcgatgatccc
aagatcgaaaagccaaccgatgttatcatccggctgaccacgaccaacatttgcgggtcc
gaccttcacatgtacgagggccgtaccagctttgagaagggcagggtcttcggtcacgaa
aaccttggcgaggtcatcgaagtcggcgctgccgtagatcgtatcaagaagggcgatcgc
gtctgcatgccgttcaacgtcggttgcgggttctgcgaaaattgcgaacgcggtctgacg
ggtttttgcctcacgaccaatcctggaaccgccggcgcagcgtatggctttgccgagatg
gggccgtggcaaggcggtcaggccgagttgatgcgcattccttatgcagacttcaattgc
ctgaaactgcccgaggacgccgaagagaaggaggacgactatgtcatgctctccgacatc
ttcccgacgggttggcatggcgtcgaactgtcaggtttcttgcctggtgagagtatcgcg
atctatggggctggtccggtcggtttgatggccgcgcactcagccgaaattcgcggtgcc
tctcagatcttcgtggtcgattctcacgatgaccgactgaaactcgccgaggcgatgggc
gccattccgatcgacatgcgcaagggcgatcccgcccagcagatccttgacgcaaccggc
ggcctcgggaccgaccggggggtcgaggcggtcggataccagtgttgcgatcgccacggc
aaggagcgcagcaattacacgatgaactgcctcgtcaaaagcacgaaggccaccggcgga
atcggtgtcgtcggcgtgttcattccggaagacccgaacgcgcccgacgatctccagaag
gaaggcaagatggcgttcgacttcggcaacttctggttcaagggccagaagatcggcacc
ggccagtgcaatgtaaagcactacaaccggcgactgatgaagcttatcgagcaagaccgg
gccaatcctgcccaaatcatctcgcaccgactgccgcttgatcaggcaccagacgcctac
aagcatttcgacgagcgcgatgctggttggacgaaggtcgtgctcaagccgggcacctga

DBGET integrated database retrieval system