KEGG   Shinella sp. HZN7: shn_00575Help
Entry
shn_00575         CDS       T04278                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
shz  Shinella sp. HZN7
Brite
KEGG Orthology (KO) [BR:shz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    shn_00575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ANH02678
UniProt: A0A1A9FWH2
Position
complement(119795..120187)
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVEPYYLADQSDPDDSRYVWGYRVVIANHSDVAVRLMTRYWHITDQNGQ
VDEVNGPGVIGEQPVLRPGDTYEYSSGCPLETPSGIMFGRYRMEAENGEAFDVAIPAFSL
DTPGQARTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtgcgctgacccgcgacatcgaagtgaccgtagagccgtattatctggccgac
cagtccgatcccgacgacagccgctatgtgtggggataccgggtggtcatcgcgaaccat
tccgatgtcgccgtgcggctgatgacgcgctactggcacattaccgaccagaacggccag
gtcgacgaggtgaacggacccggcgtcatcggcgagcagccggtgctacgccccggcgac
acctacgaatattcctccggctgcccgctcgaaacaccctcgggcatcatgttcggccgc
taccgcatggaagcggagaacggcgaggcgttcgatgtggcgataccggcgttctcgctc
gatacgccggggcaggcgcgcacgctcaactga

DBGET integrated database retrieval system