KEGG   Shinella sp. HZN7: shn_03515Help
Entry
shn_03515         CDS       T04278                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
shz  Shinella sp. HZN7
Brite
KEGG Orthology (KO) [BR:shz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    shn_03515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ANH03198
UniProt: A0A1A9FY10
Position
complement(728227..729729)
Genome map
AA seq 500 aa AA seqDB search
MANSQVQLRKPTLDKDLEKLTFTEQATHFVLRSWTGVGIALVFLLIAMAVANSFATGTPG
VLVVAITAALAAYMAMNIGANDVTNNVGAAVGARAMSLGVALVIAAVFEIAGALLAGQGV
AATVASGIVDRSIFPTPETYAWAMMAALVSAALWINIATIANAPISTTHAIIGGVIGAGA
AASGFHSVQWDAIAVIVVSWTVSPILGGVIAALFLYFIKEFIIYREDKIGAARTWVPVLV
AVMAGAFAAFIVNGGTNGTVDLSFRTALLIGLGVGLATYVVTRPIVRRHAEGLDNRNQSL
RTLFRIPLICSAALLSFAHGANDVSNAVGPLYGVVSALRSGAEGGTGIPLWVMVIGAFGI
SLGLLLFGPRLIRIVGSEITKLNPMRAFCVALSSAVAVLTASAFAIPVSSTHIAIGAVFG
VGLFREWYTRNSWRRIDYIRNRGSRIAPEEEEPVNLHETRRRYLVRRSHFMTIVSAWIVT
LPISAILSAIVFLALNALFT
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccaattcacaggttcagctacgcaagccgacgctggacaaggacctggaaaaactc
accttcaccgaacaggcgacgcatttcgtgctgcgctcgtggacgggcgtcggcatcgcc
ctcgtcttcctcctgatcgccatggccgtcgccaacagctttgccaccggcacgccgggc
gttctggtcgtcgccatcaccgccgcgctcgccgcctacatggccatgaacatcggcgcc
aacgacgtgacgaacaatgtcggcgcggcggtcggcgcgcgcgccatgagcctcggcgtc
gccctcgtcatcgccgcggtcttcgagatcgccggggcgctgcttgccggccagggcgtg
gcggcgacggtcgcctccggcatcgtcgaccggtcgatcttcccgacccccgagacctat
gcctgggcgatgatggcggccctcgtctccgccgcgctctggatcaacatcgccacgatc
gccaatgcgccgatctcaaccacccacgccatcatcggcggcgtgatcggcgcgggggcg
gcggcaagcggcttccacagcgtgcaatgggacgcgatcgccgtcatcgtcgtgagctgg
accgtctcaccgatcctcggcggcgtgatcgccgcgctgttcctctacttcatcaaggaa
ttcatcatctaccgcgaggacaagatcggcgcggcaaggacctgggtgccggttctggtc
gcggtcatggcgggcgccttcgcggccttcatcgtcaatggcgggaccaacggaacggtc
gacctttccttccgcaccgcccttctcatcggccttggcgtcggcctcgccacctatgtc
gtcacccggccgatcgtccggcgccatgcggaagggctcgacaaccgcaaccagtcgctg
cgcacactgttccgcatcccgctgatctgttcggcggcgctgctctccttcgcccatggc
gccaacgacgtgtcgaatgccgtcggcccgctctacggcgtcgtctcggcgctgcgttcg
ggcgcggaaggcggaaccggtatcccgctctgggtcatggtcatcggcgccttcggcatc
tcgctcggtctgctgcttttcggcccgcgcctcatccgcatcgtcggcagcgagatcacc
aagctcaacccgatgcgcgccttctgcgtggcgctgtcctccgccgtcgcggtgctgacg
gcctcggccttcgccattcccgtctcctcgacgcatatcgccatcggcgccgtcttcggc
gtcggcctgttccgcgagtggtacacgcgcaattcctggcgccgcatcgactatatccgc
aaccgcggcagccgcatcgcccccgaggaagaggagccggtgaacctccacgagacgcgc
cggcgctacctcgtgcggcgctcccatttcatgacgatcgtctcggcctggatcgtgacg
ctgcccatctcggcgatcctctcggccatcgtcttcctcgccctcaacgcgcttttcacc
tga

DBGET integrated database retrieval system