KEGG   Shinella sp. HZN7: shn_15390Help
Entry
shn_15390         CDS       T04278                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
shz  Shinella sp. HZN7
Pathway
shz00260  Glycine, serine and threonine metabolism
shz01100  Metabolic pathways
shz01110  Biosynthesis of secondary metabolites
shz01120  Microbial metabolism in diverse environments
shz01130  Biosynthesis of antibiotics
shz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    shn_15390
Enzymes [BR:shz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     shn_15390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Pyridoxal_deC OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ANH05276
UniProt: A0A1A9G2F0
Position
3178106..3179152
Genome map
AA seq 348 aa AA seqDB search
MFFASDNWAGAHPDIAQSLVTAAGGFAPAYGASDLDKRVEKAFSEIFERDVAVFFVGTGT
AANSLALASFNRPGGQVFCHREAHVNVDECNAPEFFASGAKLVPIDGPAGKLSPDALAAA
IGRFPPDFVHGGQPMAVTITQATEAGTAYTLDEIAALSDVTKAVNLPLHMDGARFANALV
HLDATPAEMTWKRGVDILSFGGTKNGCWCAEALVLFDPGKAQQMHFLRKRSAQLFSKSRF
IAAQFDAYFKDGLWLTLARHSNAMAARLAAGFETSDTARLAWPTGSNELFVVIRNDAMKA
LKEKGAVFYDWPAGPELKATMRADETLIRLVTSFATKEADVDDFLSAL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcgcttccgacaactgggccggcgcccatcccgacatcgcacagagcctcgtg
acggcggccggcggcttcgccccggcctatggcgccagcgacctcgacaagcgtgtggaa
aaggccttttcggagattttcgagcgcgacgtcgccgtcttcttcgtcggcacgggcacg
gcggcgaattccctggcgctcgccagcttcaaccgtccgggcggccaggtcttctgccac
cgcgaagcgcatgtgaatgtcgacgaatgcaacgcaccggaattcttcgcttccggtgcc
aagctggtgccgatcgacggccccgccggcaagctctccccggacgcccttgccgccgcc
atcggccgcttcccgccggatttcgtgcatggcggccagccgatggccgtcaccatcacc
caggccaccgaagccggcaccgcctatacgctcgacgagatcgccgccctctccgacgtc
acgaaggcagtaaacctgccgctgcacatggacggcgcgcgtttcgccaatgcgctcgtc
catcttgacgcgacgccggccgagatgacctggaagcgcggcgtcgacatcctctccttc
ggcggcacgaagaacggctgctggtgcgccgaggcgctggtgctgttcgatcccggcaag
gcgcagcagatgcatttcctgcgcaagcgctcggcccagctcttctccaagtcccgcttc
atcgccgcccagttcgatgcatatttcaaggacggcctctggctcaccctcgcccgtcat
tccaacgccatggccgcgcgccttgcggccggtttcgagacctccgacacggcccgcctc
gcctggccgaccggatcgaacgaactcttcgtcgtcatccgcaacgacgcgatgaaggcc
ctgaaggagaagggagccgtcttctacgactggcccgccggccctgagctgaaggcgacc
atgcgcgcggacgaaacgctgatccggctcgtcacgagcttcgccacgaaggaagccgac
gtcgacgacttcctctcggcgctctga

DBGET integrated database retrieval system