KEGG   Shinella sp. HZN7: shn_20360Help
Entry
shn_20360         CDS       T04278                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
shz  Shinella sp. HZN7
Pathway
shz00071  Fatty acid degradation
shz00072  Synthesis and degradation of ketone bodies
shz00280  Valine, leucine and isoleucine degradation
shz00310  Lysine degradation
shz00362  Benzoate degradation
shz00380  Tryptophan metabolism
shz00620  Pyruvate metabolism
shz00630  Glyoxylate and dicarboxylate metabolism
shz00640  Propanoate metabolism
shz00650  Butanoate metabolism
shz00900  Terpenoid backbone biosynthesis
shz01100  Metabolic pathways
shz01110  Biosynthesis of secondary metabolites
shz01120  Microbial metabolism in diverse environments
shz01130  Biosynthesis of antibiotics
shz01200  Carbon metabolism
shz01212  Fatty acid metabolism
shz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    shn_20360
   00630 Glyoxylate and dicarboxylate metabolism
    shn_20360
   00640 Propanoate metabolism
    shn_20360
   00650 Butanoate metabolism
    shn_20360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    shn_20360
   00072 Synthesis and degradation of ketone bodies
    shn_20360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    shn_20360
   00310 Lysine degradation
    shn_20360
   00380 Tryptophan metabolism
    shn_20360
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    shn_20360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    shn_20360
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    shn_20360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shz04147]
    shn_20360
Enzymes [BR:shz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     shn_20360
Exosome [BR:shz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   shn_20360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANH06155
UniProt: A0A1A9G4Q2
Position
complement(4246031..4247215)
Genome map
AA seq 394 aa AA seqDB search
MTKDVAVLAATRTGIGAFQGSLANLPASDLGAALIRSVLEETGIAPEEIDEVILGQVVSA
GGGQNPARQAALKAGLPHAVPALTLNKVCGSGLKAVHLAAQAIRARDADLVLAGGQENMS
LAPYLLPRARTGLRLGHAQIEDSLIRDGLWDAFNDCHMGITAENLAERYSITREDQDAFA
AASQNKAVTASASGRFRDEITPITIPQRRGDPVVFDTDEQPRADTTAEGLAKLKPPFRKD
GTVTAGNASTINDGAALLVLASAAKAKTLGLPVLGWIRGYSSAGVDPAIMGIGPVSATQR
TLKRAGWTIGDLDLIEANEAFAAQALAVNKELGWDTSKVNVNGGAIALGHPIGASGARIL
VTLIHEMQRRGARKGLATLCIGGGQGVALALEAN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaggacgtcgccgtactggcagcaacacggaccggcatcggtgccttccagggc
agccttgccaacctgccggcctccgatctcggtgccgcgctgatccgcagcgtgctcgag
gagacgggaatcgcccccgaagaaatcgatgaggtcattctcgggcaggtcgtttcggcc
ggaggcggacagaatccggcgcgccaggccgccctcaaggccggcctcccccatgcggtg
ccggcactcacgttgaacaaggtctgcggctcgggcctgaaggcggtccatcttgcggct
caggcgatccgcgcccgggacgccgatctcgttctggccggcggccaggagaacatgtcg
cttgccccctatctgctgcccagggcccgcacgggacttcggctcggccatgcacagatc
gaggacagcctgatccgggacggtctctgggacgccttcaacgattgtcacatgggcatc
acggccgagaacctcgcggagcgctattcgatcacgcgtgaggatcaggatgcgtttgcc
gccgcctcgcagaacaaggccgtcaccgcgagcgcttccggccgtttccgcgacgagatc
acaccgatcaccattccacagcgcaggggtgacccggtcgttttcgacaccgacgagcaa
ccgcgcgcggacacgacggcagaaggactcgccaagctcaagccgccctttaggaaggac
ggcacggtgaccgctggcaatgcctcgacgatcaacgacggcgccgccctgctcgtactc
gccagcgcggccaaggcgaagaccctcgggctgcccgtgctgggttggatcagaggatat
tccagcgccggcgtagatcccgccatcatgggcattggcccggtcagcgccacgcagcgc
acgctcaagcgggccggctggaccatcggcgatctcgatctcatcgaggccaacgaggct
ttcgcggcacaggcgctggctgtgaacaaggagctcggctgggatacttcgaaggtcaac
gtcaacggcggcgcgatcgcgctcgggcatcccatcggcgcctcgggggcgcgcatcctt
gtgacgctcattcatgagatgcaacgacgtggcgcgcggaaaggtctggcgacgctgtgc
atcggtggtggacagggcgtggctctggcgctggaggcgaactga

DBGET integrated database retrieval system