KEGG   Shinella sp. HZN7: shn_23065Help
Entry
shn_23065         CDS       T04278                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
shz  Shinella sp. HZN7
Pathway
shz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:shz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    shn_23065
Enzymes [BR:shz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     shn_23065
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     shn_23065
    1.1.1.-  
     shn_23065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ANH07027
UniProt: A0A1A9G794
Position
pShin-01:144463..145536
Genome map
AA seq 357 aa AA seqDB search
MKALRFHAAKDLRIEEVDAPPSPGPGEVLVENRFCGICGTDLHEYAYGPIFVPKEPHPFT
GAHGPQILGHEFGGVVKAVGAGVAHVKPGDRVSIQPLIMPRQGDYYADRGLFHLSGNLAL
AGLSWHSGGMAEAALLNDYNVQPIPDALSDEEAALIEPTAVAVYACDRGGVTAGNSVLVT
GAGPIGILVAMAARAAGASQLFLSDLNDTRLALAREALGTVRTINPKTEKVGDVIRAETE
GGVGCDVAIECVGNEHALKNCADAVHKQGVVVQTGLHPGENPLNWFDVTFKDIDIRGSWA
YPTHYWPRVARLVASGQIPASRIVTKYVSLREAVSEGFDQLLDPAGKHLKILIDLSR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctgcgctttcacgccgccaaggatctgcgcatcgaggaggtcgatgccccg
ccgtcgcccggcccgggcgaggtgctggtcgagaaccgcttctgcggcatctgcggcacg
gacctgcatgaatatgcctatggcccgatcttcgtgccgaaggagccgcatcccttcacc
ggcgcgcacgggccgcagatcctcggccacgaattcggcggcgtcgtcaaggcggtcggc
gcaggcgtcgcacatgtgaagcccggagaccgggtgtcgatccagccgctcatcatgccc
cgccagggcgactactatgccgatcgcggcctctttcatctcagcggcaacctcgcgctt
gccggcttgtcctggcattccggcggcatggccgaggccgcccttctcaacgactacaat
gtccagcccattccggatgccctgagcgatgaggaggccgcgctcatcgagccgacggcg
gtcgccgtctatgcctgcgatcgcggcggcgtgacggccggcaacagcgtgctcgtcacc
ggcgccgggccgatcggcattctcgtcgccatggcggcgcgtgccgcgggcgcctcgcag
ctctttctctccgatctcaacgacacgcggctggcgctggcgcgcgaggcgctgggcacg
gtgcgcaccatcaatccgaagacggaaaaggtgggcgacgtcatccgcgccgagacggag
ggcggcgtcggctgcgatgtcgccatcgaatgcgtcggcaacgagcatgcgctgaagaac
tgcgccgatgcggtgcacaagcagggcgtcgtcgtgcagaccgggcttcaccccggcgag
aacccgctgaactggttcgacgtcaccttcaaggacatcgatatccgcggctcctgggcc
tatccgacccactactggccgcgcgtcgcccggctggtcgccagcggccagatcccggca
agccgcatcgtcacgaaatatgtctcgctccgcgaggccgtttcggaagggttcgaccag
ttgctcgacccggccggcaagcacctgaaaatcctgatcgacctttcccgttag

DBGET integrated database retrieval system