KEGG   Shinella sp. HZN7: shn_28130Help
Entry
shn_28130         CDS       T04278                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
shz  Shinella sp. HZN7
Pathway
shz00350  Tyrosine metabolism
shz00360  Phenylalanine metabolism
shz00380  Tryptophan metabolism
shz01100  Metabolic pathways
shz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    shn_28130
   00360 Phenylalanine metabolism
    shn_28130
   00380 Tryptophan metabolism
    shn_28130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shz04147]
    shn_28130
Enzymes [BR:shz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     shn_28130
    4.1.1.105  L-tryptophan decarboxylase
     shn_28130
Exosome [BR:shz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   shn_28130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ANH08007
UniProt: A0A1A9GA65
Position
pShin-03:complement(199241..200653)
Genome map
AA seq 470 aa AA seqDB search
MDSEEFRQWSRTAADWGADYRAGLRDRPVRAQTKPGDIARQIARTPPEDGEAMEAIFADF
ERIIPDGLTHWQHPRFFAYFPANAAPVSVIADYLVTSVAAQCMLWQTSPAATELETRVVD
WLRQALGLPEGFSGVIQDSASTATLAAMLVMREKALGWKGNSEGLAAHGAVRVYASKQVH
TSIDRAIWIAGIGEANLVRIPTRGPLNGMAPEVLDAAIRADRAAGHIPAGIIACTGGTSI
GACDPIRDVAAVAKAHGLYLHVDAAWAGSAMICPEFRNLWEGVEAADSIVFNPHKWLGAN
FDCSVQFIRSPEDQVRTLAIQPEYLKTHGHDGIINYSEWSVPLGRRFRALKLWFLLRYHG
LEGLRTMIRNHVAWSRELAERLAGEPDFEIVSEPVLSLFSFRHKGGAEADRHNIALVNAI
NDDGRIYLTQTRVDGRIAIRFQAGQFEMTRDDADTAFTVITEIARSLEDA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgaagaattccgccagtggtcgcgaacggccgccgattggggcgcagactac
cgcgcgggcctgcgtgaccggccggtgcgggcgcagacgaagccaggcgatatcgcccgg
cagatcgcccgtacgcccccggaagacggcgaggcgatggaagcgatcttcgcggatttc
gagcgcatcattcccgatggcctcacccattggcagcatccgcgcttcttcgcctatttt
ccggccaatgccgcgcccgtttcggtgatcgccgactatctcgtcacctccgtcgccgcc
cagtgcatgctctggcagacctcgcccgccgccaccgagctcgagacgcgggtggtcgac
tggctgcgccaggcgctcggcctgccggagggcttttccggcgtcatccaggattccgcc
tctaccgcgacgctcgccgccatgctggtcatgcgcgagaaggcgctcggctggaaaggc
aacagcgaggggctggcggcgcacggggcggtgcgcgtctatgcgtcgaagcaggtgcac
acctccatcgaccgggcgatctggattgccggcatcggcgaggcgaacctcgtgcgcatc
ccgaccaggggccccctcaacggcatggcccctgaggtgctcgatgccgcgatccgcgcg
gatcgtgccgccggccatatcccggccggcatcatcgcctgcaccggcggcacctccatc
ggcgcctgcgacccgatccgcgatgtggcggcagtggccaaggcgcatggcctctacctg
catgtcgatgccgcctgggcgggctcggccatgatctgcccggaattccgtaatctctgg
gaaggcgtcgaggcggccgattccatcgtcttcaacccgcacaaatggctcggcgccaat
ttcgactgctcggtgcagttcatccgcagcccggaagaccaggtgcgcacgctggccatc
cagccggaatacctgaagacgcacggccatgacggcatcatcaactattccgaatggtcc
gtgccgctcggccgccgcttccgtgcgctgaaactgtggttcctgctgcgctaccacggc
ctcgaagggctgcgcacgatgatccgcaatcatgtcgcctggtcgagggaactggcggag
cgtcttgccggcgagccggatttcgagatcgtcagcgagccggtgctctcgctcttctcc
ttccgccacaagggcggcgcggaggccgaccggcacaatatcgccctcgtcaacgccatc
aacgacgacggccgtatctacctgacgcagacccgcgtcgacggccgcatcgccatccgc
ttccaggccggccagttcgagatgacccgcgacgacgcagacaccgccttcacggtcatc
accgaaatcgcccgctcgctggaagacgcctag

DBGET integrated database retrieval system