KEGG   Sulfolobus islandicus M.14.25: M1425_0671Help
Entry
M1425_0671        CDS       T00890                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00010  Glycolysis / Gluconeogenesis
sia00620  Pyruvate metabolism
sia00640  Propanoate metabolism
sia00680  Methane metabolism
sia00720  Carbon fixation pathways in prokaryotes
sia01100  Metabolic pathways
sia01110  Biosynthesis of secondary metabolites
sia01120  Microbial metabolism in diverse environments
sia01130  Biosynthesis of antibiotics
sia01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1425_0671
   00620 Pyruvate metabolism
    M1425_0671
   00640 Propanoate metabolism
    M1425_0671
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    M1425_0671
   00680 Methane metabolism
    M1425_0671
Enzymes [BR:sia01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     M1425_0671
Lipid biosynthesis proteins [BR:sia01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   M1425_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N PATR
Motif
Other DBs
NCBI-ProteinID: ACP37494
UniProt: C3MVQ7
Position
complement(623737..625560)
Genome map
AA seq 607 aa AA seqDB search
MVFNPNKEWIENSNVYKFMVEKNLDKLEDFIKYTYENPEFWDEFVKLINVKFPEPYTKVL
DLSRGKQWPQWFIGGKLNIGDQLRDSSDVFIKWMDESFNTRTVTYSQILNESKSIGSWLK
RIGLKKGDRVAIYMPMIPEIVSVMLGAVRAGMILVPLFSGFGPEPIRVRVEDSEAKVIFT
VDKSIRRGKEVGMLRNLEGLNIAKVVLNRGGTKGDFYDYKDVIRTGGDYVENTGTEDPMM
IIYTSGTTGKPKGCVHTHDGFPIKASADIYFQFDLKKDETLMWVTDMGWMMGPWMVFGSL
LLDAKMGMIEGYTGGEVLQKFVEDMKVDVLGVSASLVRALRSQGEVKLNVRLTGNTGEPI
DPESWYWLFNASGKNPIINYSGGTEISGGILGNYVIKKIKPSSFNGPSPGINASVFNEEG
KEAPPNVEGELVILSVWPGMTRGFWRNPERYIETYWSIWKDIWVHGDLAYRDEEGYFYIV
GRSDDTIKVAGKRVGPAEIESVLNSFPNVVESACVGVPDPMKGEKIVCFVVSKVGDIEKD
LIRYTEDKLGKAFAPSEIKIVKELPKTRNAKIMRRLIRAVYLNKPLGDISSLENPSALEE
IKRALIS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggtatttaatccaaataaggaatggatagagaatagcaatgtatacaagttcatggtt
gaaaagaacctcgataaactagaagacttcattaaatatacatacgagaatccagaattt
tgggatgagtttgtaaagttaataaacgtgaaatttccagaaccttacacgaaggttcta
gatctaagtaggggaaagcaatggcctcaatggttcatagggggaaagttaaacattggt
gaccaattacgcgatagttctgatgtgtttattaagtggatggatgagagcttcaacact
agaacggtaacctattctcaaatactaaatgagagcaagtcaattggaagttggttaaag
agaataggtttaaagaaaggagatagggttgccatttacatgccaatgatcccggaaata
gtatcggtaatgttaggtgcagttagagcagggatgatactcgtacctctattttctggg
tttggcccagagccaataagagttagagtagaggatagtgaggctaaagtaatcttcacg
gtcgataagagcattagaaggggaaaagaagttggtatgttgagaaatctggaaggacta
aatatagctaaagtagtattgaataggggaggtactaagggtgatttttatgactataag
gatgtaataagaactggtggagactatgtagaaaatactggtactgaagacccaatgatg
ataatttacacttctggaactactggaaaacccaagggatgtgttcatactcacgatgga
tttccaataaaagcatctgctgacatttacttccagttcgatctgaaaaaagatgagacc
ttaatgtgggttaccgacatggggtggatgatgggaccgtggatggtatttggatcactc
ttactagatgctaaaatggggatgattgaagggtatacgggtggggaagtcctacagaaa
ttcgttgaagatatgaaggttgatgttttaggagtctcagctagtctggttagagcgtta
agaagtcaaggtgaagttaaactaaacgttaggctaacaggaaatactggagaaccaatt
gatccggaaagctggtattggttatttaacgctagtggaaagaaccccattataaactat
tctggaggtactgaaatctctggaggtattttagggaattacgttataaagaaaataaag
ccatcttcatttaatggtccttccccgggaattaatgcttcagtatttaatgaggaagga
aaagaagctccaccaaatgttgagggggaattggttatattgagtgtctggccaggtatg
accaggggattttggaggaatcccgagaggtatattgagacttattggtcaatttggaaa
gatatatgggttcacggagatttggcttatagagatgaagaagggtatttttatattgtt
ggaagaagtgatgatacgataaaggtcgctggaaagagagtaggtccagctgaaattgaa
agtgtgttaaattcctttccaaatgtagttgaatcagcatgtgtcggagttccagatcca
atgaagggagagaaaatagtctgtttcgtagtctcaaaggttggcgatattgaaaaggac
ttgataagatatacagaggataaactgggtaaagcatttgcaccatcagaaataaagatc
gttaaggagttacctaaaactagaaatgcaaaaataatgagaagactgataagggcagta
tacttaaataaacccttaggggatatctcctcactagaaaatccatcagctttagaggaa
ataaagagggccttgattagctga

DBGET integrated database retrieval system