KEGG   Sulfolobus islandicus M.14.25: M1425_0843Help
Entry
M1425_0843        CDS       T00890                                 

Definition
(GenBank) catalytic domain of components of variousdehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00010  Glycolysis / Gluconeogenesis
sia00020  Citrate cycle (TCA cycle)
sia00620  Pyruvate metabolism
sia01100  Metabolic pathways
sia01110  Biosynthesis of secondary metabolites
sia01120  Microbial metabolism in diverse environments
sia01130  Biosynthesis of antibiotics
sia01200  Carbon metabolism
Module
sia_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M1425_0843
   00020 Citrate cycle (TCA cycle)
    M1425_0843
   00620 Pyruvate metabolism
    M1425_0843
Enzymes [BR:sia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M1425_0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT Peptidase_M23 Transferase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ACP37644
UniProt: C3MWI6
Position
795519..796703
Genome map
AA seq 394 aa AA seqDB search
MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKITTAVKAAASGILLKIY
AKEGEEVPVGQIIAYIGEIGEKPPSLSTKPTLVSEQQQGQPTRIEEAKAISEVRASPRAR
RLAKEKGIDLVKIKGSGPGGMITEDDVIRELENIEKGVKFTATGLRVKEVIPMTAIRQEI
SRRMVQSLQTMAQVTLNIEINANSLVKIKNEVESKYSMKITYTDVLVKVVAKLIRSHPFL
NATLEGDQIKIIEDVNIGIAVALDQGLIVPVIRNADIKPITEIAKESHELADKARENKLN
PDEVTGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRKAPVVIGDNISIGYVMWLSL
TFDHRVLDGHTAAKFLKELTEILEDENRLRAFLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagaagtattaatgccaaagttaggtttaacaatgactaaagggaaaatagtt
caatggaagaaaaaagaaggagatagagttcaagaaggagaggacttagtaataatagaa
actgagaaaataacaactgcagtaaaagcagcagctagcggtatcttacttaagatttac
gccaaagaaggtgaagaggtacctgttggtcaaataatagcgtacataggtgaaattgga
gaaaaacccccatccttatctactaaacccactttggttagtgaacagcaacaagggcaa
ccaactcgaattgaagaggctaaggcaataagtgaagtaagagcttcacctagagctaga
aggcttgctaaagaaaaaggaatagatctagttaaaataaaggggagtggacctggaggt
atgataacagaagatgatgtaattagagagttagaaaatattgaaaaaggagtgaaattc
actgccactggtcttagagttaaagaagtgataccaatgactgcaataaggcaagaaata
agtagaagaatggttcagagccttcagacaatggcccaagtgacactaaatattgagatt
aatgcaaattcgttagttaaaataaaaaatgaagtagagtctaagtatagcatgaaaatt
acttatacagacgttctagttaaagtagtagctaaactcatcagaagtcatccatttcta
aacgcaacactagagggcgatcaaataaagataattgaggatgttaatataggaatagct
gtggctctagatcagggattaatagtaccagtaataaggaacgcagatattaagccaatt
actgaaatagcaaaagaaagtcatgaactagcggataaggctagagaaaacaagttaaat
cccgacgaagtaacaggaggaacgtttacgataagtaatttaggaatgtatgatatagat
tcatttacaccaattataaatcctcctcaaactgctatattgggagtaggtaggataaga
aaggcaccagttgtaataggcgataatatctcaatcggttacgttatgtggctaagttta
acatttgatcatagagtgttagatggacataccgctgctaagttcttgaaagagcttact
gaaatattagaggatgagaatagattgagagcgtttttaagttag

DBGET integrated database retrieval system