KEGG   Sulfolobus islandicus M.14.25: M1425_1332Help
Entry
M1425_1332        CDS       T00890                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sia  Sulfolobus islandicus M.14.25
Pathway
sia00260  Glycine, serine and threonine metabolism
sia00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sia01100  Metabolic pathways
sia01110  Biosynthesis of secondary metabolites
sia01130  Biosynthesis of antibiotics
sia01230  Biosynthesis of amino acids
Module
sia_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sia00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M1425_1332
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M1425_1332
Enzymes [BR:sia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M1425_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACP38086
UniProt: C3MV91
Position
complement(1264075..1265352)
Genome map
AA seq 425 aa AA seqDB search
MVKEDEILPKYWYNIIPDLPKPLPPPRDPQGADFSRIDLLRSILPKEVLRQQFTIERYIK
IPEEVRDRYLSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAK
EEGIDHVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYAS
PTNLTEYGKKILETNPQHPGSLGIAMSEAIEYALKNEFRYLVGSVLDVVLLHQSVIGQET
ITQLDLLGEDADILIGCVGGGSNFGGFTYPFIGNKKGKRYIAVSSAEIPKFSKGEYKYDF
PDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPTLSLLAKEGIVEWREYNEREIFDA
AKIFMENQGIVPAPESAHAIKAVVDEAIEARKNNERKVIVFNLSGHGLLDLSNYESMMKR
LNGNG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagacgagattttgcctaagtactggtacaatataattcccgatctgcct
aaacccttgcctcctccaagggatccacaaggggcagatttctcgagaattgatttatta
agaagtatactacctaaggaggtattaaggcaacaattcacaatagaaagatacataaag
atccctgaggaagtaagagataggtatttatcgataggaagaccaactccattatttaga
gctaaaagattagaggagtacttaaagacaccagcaagaatctactttaaatatgaaggc
gctacacctactggatctcataagataaatacagcaattcctcaagcatatttcgcaaaa
gaagagggaattgatcacgtagttactgaaactggagcaggtcaatggggaactgcagta
gcacttgcagctagtatgtataatatgaaaagtactatcttcatggtaaaggtaagttat
gaacaaaaaccgatgagaaggagcataatgcaattatatggggctaatgtttatgcaagc
cccacaaacttaactgaatacggtaagaagatattagagacaaatccacagcatcctgga
tcactaggtatagcaatgagtgaggcaatagagtatgctcttaagaacgaatttagatat
ttagtaggtagcgttttagatgtagtacttttgcatcaaagcgttattggtcaagagact
attacccaattggatttgttaggagaagacgctgatattctaattggatgcgtaggaggt
gggagcaattttggtggttttacatatccctttatcggaaacaagaaaggcaaacgctac
attgcagtaagttctgcagaaattccaaagtttagtaaaggtgaatataagtacgatttt
ccagactctgctggattattacctttagtgaaaatgataactttaggtaaagattacgtt
cctccgccaatatatgcaggcgggttaagatatcatggtgtagcaccaacattaagtttg
ttagcaaaggagggtattgtggaatggagagaatataatgaaagggagattttcgacgcc
gctaagatatttatggagaatcaaggtattgtaccagctccagaatcagcccatgcaata
aaggcagtggtcgatgaagctatagaagctaggaagaataatgagcgaaaagtcatcgtc
tttaatctaagtggacatggattgttggatctatcaaattacgaatccatgatgaaaagg
ttgaatggaaatgggtaa

DBGET integrated database retrieval system