KEGG   Streptococcus intermedius B196: SIR_1077Help
Entry
SIR_1077          CDS       T02830                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sib  Streptococcus intermedius B196
Pathway
sib00561  Glycerolipid metabolism
sib00640  Propanoate metabolism
sib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SIR_1077 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SIR_1077 (gldA)
Enzymes [BR:sib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SIR_1077 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AGU76438
UniProt: T1ZEU5
Position
complement(1126207..1127295)
Genome map
AA seq 362 aa AA seqDB search
MNIFASPSRYIQGENALFENASQILKLGSRPVLLCDDVVYQIVGEKFQAYLTRYGLHVLH
VSFNGEASDNEINRVVALAEKDGADLVIGLGGGKTIDSAKAIADLLGSPVVIAPTIASTD
APTSALSVIYTEEGAFEKYIFYTKNPDLVLVDSKVIAQAPKRLLASGIADGLATWVEARA
VMQANGETMLGQRQTLAGAAIAQKCEETLFADGLQALAACEAQVVTPALEHIIEANTLLS
GVGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLTQLFLENRPKEELEKYIRFY
QKIGMPTTLAEMHLENASYDDLLKVGKQATIEGETIHQMPFKISASDIAGAILAVDRYVN
SL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttttgcaagtccgtctcgttatattcagggtgaaaatgccctctttgaaaat
gccagtcaaatcctcaaattaggtagtcgccctgtgttgctttgtgatgatgtcgtctac
cagattgttggagagaaatttcaggcttatctaactcgatatggtcttcatgtgctgcat
gttagttttaatggtgaagcttcggataatgaaatcaatcgggtagtcgctttagctgaa
aaagatggagccgatctagtgattggtcttggcggtggaaaaacaattgacagtgctaag
gcaattgcagatttattgggaagtccagtcgtaattgcaccgactattgcttcaacagat
gcaccaacatcagctctttcagtaatttatactgaggaaggagcatttgagaaatatatt
ttttacaccaagaacccagatcttgtcctggtagattcaaaggttattgctcaagctcca
aagcgcttgttagcttctggaattgcagatggtttagcgacttgggttgaagcgcgtgcg
gttatgcaggcaaatggagagaccatgctaggacaaagacagactttagcaggcgcagct
attgcccaaaaatgtgaagaaactctttttgcagatggtttacaagcactggctgcttgt
gaggcgcaggtggtaacaccagcccttgagcatatcattgaggctaatacgcttctcagc
ggtgttggttttgaaagtggtggattggctgcggctcatgccattcataatggatttacg
gctctgactggtgatattcatcatctgactcatggagaaaaagtagcttatggaacgcta
acacagctctttcttgaaaaccgtccaaaagaggaattggaaaaatatattcgtttctat
cagaaaattggtatgcctacgactttggcagaaatgcatttagaaaatgccagctatgat
gatttgctcaaggttggtaagcaagctactattgaaggtgaaaccattcatcagatgccg
tttaagatttcagcatctgatattgcgggtgctatcctagcagtcgatcgttatgtaaac
tccttataa

DBGET integrated database retrieval system