KEGG   Streptococcus intermedius B196: SIR_1403Help
Entry
SIR_1403          CDS       T02830                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sib  Streptococcus intermedius B196
Pathway
sib00520  Amino sugar and nucleotide sugar metabolism
sib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SIR_1403 (nagA)
Enzymes [BR:sib01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SIR_1403 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AGU76759
UniProt: T1ZES7
Position
complement(1474039..1475190)
Genome map
AA seq 383 aa AA seqDB search
MPKYIQADQFFYPHGIRQGGYLELVDGKFGKWTKEIPTGADVIDYTGYSIAPGLVDTHIH
GFGGVDVMDNNIEGTLHTMSEGLLSTGVTSFLPTTLTSTFESLLAVTENIGAHYQEATGA
KIRGLYFEGPYFTEKYKGAQNPIYMKNPRMDEFRAWKKASNGLLNKIALAPEREGVEDFV
RTITDEGVTVALGHSNATFEEAKAAVDAGASVWVHAYNGMRGLTHRELGMVGAMYELPHT
YAELICDGHHVDPKACDILMKQKGHENVALITDCMTAGGLEDGDYMLGEFPVVVANGTAR
LKSTGNLAGSILKLKDGLKNVVKWGIANPHEAVMMATLNPAKSVHIEDVCGQIKEGHDAD
FIVLDKDLELVATYLDGEKRYEA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaatatattcaagcagatcaatttttctatccccatggtattcgtcaaggtggc
tatctagaattagtggatggtaaatttggtaaatggacaaaagaaatcccaacaggtgcg
gatgtgatagattatacaggctattctattgcaccgggcttagttgatacgcatattcat
ggttttggtggtgtagatgtgatggacaataatattgaaggaactctgcataccatgagt
gaaggtctgttgtcgacaggtgttaccagttttttgccgacaaccttaacctcaactttt
gaatcgttactagcggtcacggaaaatatcggtgctcattatcaagaagcgacaggtgct
aagattcgtggcttatattttgaaggtccgtatttcacagaaaaatataaaggagcccaa
aatccaatttacatgaaaaatcctcgaatggatgaatttcgtgcttggaaaaaagcatcg
aatggtttgctcaataaaatcgctctagctccagaacgagaaggtgtggaagattttgtt
cgaactattactgatgaaggggttacggttgcacttgggcactcaaatgcaacgtttgaa
gaagcaaaggctgcggtagatgcaggtgccagtgtttgggtacatgcttataatggtatg
cgcggcttaacccaccgtgagttggggatggttggcgctatgtatgaattgccacacact
tatgctgaattaatctgtgatggacaccatgttgatccaaaagcttgtgacatcttgatg
aagcaaaaagggcatgaaaatgttgcgctcatcacagactgtatgactgcaggaggcttg
gaagacggtgactatatgttgggagaatttccagtagtagtcgcaaatggaactgctcga
ctcaaatcaacaggtaacctcgcaggatctatcttgaaattgaaagacgggttaaagaac
gttgtcaaatggggtattgctaacccacacgaagcagttatgatggcaaccctcaatccg
gctaaatccgttcatattgaggatgtttgtggtcaaatcaaggaaggacatgatgcagac
ttcattgtgttggacaaggatttggaactggttgcgacttatcttgatggcgaaaagaga
tacgaagcataa

DBGET integrated database retrieval system