KEGG   Sulfolobus islandicus LAL14/1: SiL_0430Help
Entry
SiL_0430          CDS       T02620                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
sic  Sulfolobus islandicus LAL14/1
Pathway
sic00250  Alanine, aspartate and glutamate metabolism
sic00330  Arginine and proline metabolism
sic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SiL_0430
   00330 Arginine and proline metabolism
    SiL_0430
Enzymes [BR:sic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     SiL_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AGJ61903
UniProt: M9U743
Position
390708..392261
Genome map
AA seq 517 aa AA seqDB search
MVFVNEKTYQRYVEERREEEFHKEYERALNHIELGKEYPILIGKDEIKLSSKYIVKTPVD
TSLTFAITQKDDGNNLRNAIKIARESFDYWQYSDWKDRVEFAYKAAEELRRRKFELAAII
TYENGKNRYEAIAEVDETIDYFLYYAKLLEDNRGYIRQMEGRIYKNEKAFSVMRPYGTWL
IISPFNFPLAITATMTLGALLTGNTVVVKPSSDTPVSAYMLVTIMRRAGFPLEAVNYVTI
PGELITPALDEVDGFAFTGSRDVGHKLLKTFINRKPRPAVLELGGKNATIITAKADLNKA
IEGTFKGAFGYGGQKCSATSRAFVESPIYDEFLKRLKEKVEKTVIGDPRKRETFLGPIIN
KGAIEKFRRYVKQAVEEGGKILVGGRVIDDEKIYLVEPTIIVELPYSSPLWKTELFVPIL
LVKEVKSLEQAVKLANDVDYGLTAGIFSDDPKEIQYLFDHIEAGVVYANRTAGSTTGAMP
GVQPFGGWKDSGWTGRNAGGPYYLLSFMREQARTVYD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggtatttgtaaatgaaaaaacttatcaaagatatgtagaggagagaagggaggaggaa
tttcataaggaatatgaaagagcgttaaatcatattgaacttggaaaggagtatcctatc
ttgattggtaaggacgaaatcaaactttcatccaagtatatagttaaaactccagttgac
acaagtttaactttcgcaattactcaaaaggatgatggtaataatttacgtaacgcaata
aagattgctagggaatcctttgattactggcaatactcagattggaaagatagggtagag
tttgcatataaagcagctgaggagttaaggagaagaaagttcgagcttgccgcaataata
acttacgaaaacggtaaaaacagatatgaagcaatagcagaagtagacgaaaccattgat
tactttctctattacgctaagcttttggaggataataggggatacataagacagatggaa
ggtaggatatacaagaatgaaaaagcattttcggtaatgagaccttatggtacttggtta
ataatttccccattcaactttccattagccatcactgccacaatgactttaggagcacta
ctgactggaaatacagtagtagtgaagccgtcatcagatactcccgtttcagcctatatg
cttgtaaccattatgagaagagcgggattcccacttgaagcagtaaattacgtcacaata
cccggagagcttataacaccagccttggatgaggttgacggtttcgcatttacgggttct
agggatgttggacacaaattgctaaagacgtttataaataggaagccaagaccagctgtt
ctcgaattgggcggaaagaatgctacaataattaccgcaaaggccgatttaaataaggcg
attgaaggtacttttaaaggtgctttcgggtatggagggcaaaaatgcagtgcaacttct
agggcatttgttgagagtccaatatatgacgagttcttgaagagactaaaggaaaaggtt
gagaagactgtaataggcgatccgaggaagagggagacctttttaggtccaataataaat
aagggggctattgaaaagtttagaagatatgttaaacaagcagttgaagagggtggtaaa
atactggtgggaggaagggtaattgatgatgaaaagatctatctagtggagccgacgata
attgtggaattaccatactcaagtccattgtggaagactgaactattcgtaccaatctta
ctagtaaaggaggtcaaaagccttgaacaagctgtgaaactcgccaacgatgttgattat
ggcttgactgcaggtatcttctctgatgatcccaaggagatacaatatttgtttgaccat
attgaagctggagttgtctatgctaatagaactgctggatctaccactggagctatgccg
ggagtacagccatttggaggttggaaggattcgggttggactggaaggaatgctggaggt
ccatattatctcctctcgttcatgagagaacaagctaggacagtatatgattaa

DBGET integrated database retrieval system