KEGG   Sulfolobus islandicus M.16.4: M164_0683Help
Entry
M164_0683         CDS       T00906                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00630  Glyoxylate and dicarboxylate metabolism
sid01100  Metabolic pathways
sid01110  Biosynthesis of secondary metabolites
sid01120  Microbial metabolism in diverse environments
sid01200  Carbon metabolism
Module
sid_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M164_0683
Enzymes [BR:sid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     M164_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACR41301
UniProt: C4KF85
Position
complement(628585..629898)
Genome map
AA seq 437 aa AA seqDB search
MNIRDKWSEEEKRLEYEWSEDPRWKGIKRNYKPSDVVKLRGSIRIEYSIAKLASHKLWNL
LNTEPYIATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVKRLNNALLRADQISWSEGKRDIDYLLPIVADAEAGFGGPIHAFELTKALIEAGAAGVH
FEDQLAAEKKCGHLGGKVLIPISAFIRVLNAARLASDVLGVPTILIARTDAPNAKYLSND
VDETDNQFLTGKRTSEGYYEIRGGIEYAIARGLAYAPYADLLWFETSKPDLEEARQFAEA
IHTHYPGKLLAYNLSPSFNWKKFMDDSKISRFMTELGEMGYKFQFITLAGWHLINYHTFK
LARAYRNEGMPAYVRLQESEFQAQAEGYTAVSHQREVGTDYFDLVLTIASGGEASTTAME
GSTEAEQFVEAKQKVLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgagataaatggagtgaagaggaaaaaagacttgaatacgagtggtccgaa
gatccaaggtggaaaggaataaagagaaattataagccctcggatgtggtaaaattaagg
ggatctatcagaattgagtatagtatagctaaattagcctcacataaactttggaactta
ctaaatactgagccctatatagcaacatttggggcattaacgggttcccaagcagttgaa
atggcaaaagcgggccttaaagcaatttacgtaagtggatggcaagtagctgctgataac
aatttatcaaatcaaacttatccagacttgagcttatatccatctaacagtgttccaaac
ttagtaaagaggttaaataacgctcttttaagggctgaccaaatatcttggagtgagggt
aaacgcgatatcgattacttactgcctattgttgcagatgctgaagctggtttcggtggt
ccaattcacgctttcgaactaacaaaagccttaatagaggcaggggctgcaggcgtacat
tttgaagatcaattagcagcggagaaaaaatgtggacatttaggaggaaaagttctaatt
ccaataagtgcatttataagagtactaaacgctgcaagactagcatctgacgtattagga
gtacccacaatactaatagcaaggacagacgcaccaaatgcgaaatacttatctaacgat
gtagatgagactgataatcaatttttaactggaaaaagaacatcagagggatattatgag
attaggggaggtatcgaatacgctattgccagaggattagcttatgcaccctatgcggac
ctattatggtttgagacttctaagccagatttggaagaggctagacaatttgcagaggct
atccacactcattaccccggtaagttgttagcgtataacctatccccctcatttaactgg
aagaaatttatggatgattccaaaatcagtaggtttatgaccgaattaggagaaatgggc
tataaatttcaattcataacccttgcaggttggcacttaattaactaccatacattcaaa
ttggcgagagcatatagaaacgaaggaatgccagcatatgtaagactacaggagtcagag
ttccaagctcaagcagaaggatatacggccgtaagtcatcagagagaggttggaacagat
tacttcgacctagtgttaacaatagcatctgggggagaagcgtccactactgcaatggaa
ggttctactgaagctgaacagtttgtagaggcaaaacagaaagtattgaaataa

DBGET integrated database retrieval system