KEGG   Sulfolobus islandicus M.16.4: M164_1716Help
Entry
M164_1716         CDS       T00906                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00130  Ubiquinone and other terpenoid-quinone biosynthesis
sid00627  Aminobenzoate degradation
sid01100  Metabolic pathways
sid01110  Biosynthesis of secondary metabolites
sid01120  Microbial metabolism in diverse environments
sid01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    M164_1716
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    M164_1716
Enzymes [BR:sid01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     M164_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CoA_binding Ploopntkinase2
Motif
Other DBs
NCBI-ProteinID: ACR42320
UniProt: C4KIA6
Position
complement(1573878..1574495)
Genome map
AA seq 205 aa AA seqDB search
MVGGLAKEAGTKSGREKAKRVIIGISGASGTIYGIRTVQFLNELGYETHIIISKSAEKVA
QKELGINLIEELKKYSSNIYIQSQIEAAPSSSSFSITSESMIIIPCSIKTLAEIANGIGS
NLLSRTALNFIRTNKKLVLVIRETPLGAIELENALKLARLGVLIMPASPAFYILPKTIDE
MVNFVVGKALDLLGIKHDIYKRWKG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggttggcggattggctaaggaagcaggaacaaagagcgggagggaaaaagcaaagagg
gttattataggaataagtggcgcaagtggaacaatatatggtattaggactgtccagttt
ctaaatgaactcggttacgagacgcatattataatttctaagagtgcagagaaagtagcg
caaaaggagctaggtataaatttaattgaagagttaaagaagtattcctctaatatatat
atccaatcccagatcgaagctgcaccttctagttcaagtttttcaataacgtcagaaagt
atgattattattccatgtagtattaaaacacttgcagaaattgcaaatggaattggatcg
aatcttctatccagaactgcattaaatttcatcagaacaaacaagaagttagttttggta
attagagaaaccccattaggtgccatagaactcgaaaatgccctaaagctagctagatta
ggtgttctcataatgccagcctctcctgctttctacatcttaccaaaaaccattgatgaa
atggttaacttcgtggttggtaaagccttagatttgttgggaataaagcatgatatatat
aagagatggaaaggataa

DBGET integrated database retrieval system