KEGG   Sulfolobus islandicus M.16.4: M164_1935Help
Entry
M164_1935         CDS       T00906                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00010  Glycolysis / Gluconeogenesis
sid00030  Pentose phosphate pathway
sid00051  Fructose and mannose metabolism
sid00052  Galactose metabolism
sid00230  Purine metabolism
sid00500  Starch and sucrose metabolism
sid00520  Amino sugar and nucleotide sugar metabolism
sid00521  Streptomycin biosynthesis
sid01100  Metabolic pathways
sid01110  Biosynthesis of secondary metabolites
sid01120  Microbial metabolism in diverse environments
sid01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M164_1935
   00030 Pentose phosphate pathway
    M164_1935
   00051 Fructose and mannose metabolism
    M164_1935
   00052 Galactose metabolism
    M164_1935
   00500 Starch and sucrose metabolism
    M164_1935
   00520 Amino sugar and nucleotide sugar metabolism
    M164_1935
  Nucleotide metabolism
   00230 Purine metabolism
    M164_1935
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M164_1935
Enzymes [BR:sid01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     M164_1935
    5.4.2.8  phosphomannomutase
     M164_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Propep_M14
Motif
Other DBs
NCBI-ProteinID: ACR42538
UniProt: C4KIX4
Position
1773196..1774563
Genome map
AA seq 455 aa AA seqDB search
MGKLFGTDGIRGVTNTELQPEFALKLGKAIGTYFGKGARILIGRDVRAGGDMLLKAVESG
LLSSGVLVYEAGMAPTPAFQYGVKTLGYDGGIIITASHNPAEYNGIKVLSPHGIEISRED
EDKIEDIYFNNKFHVVEWNGLVNDVKREDKVIETYVQGILSHVDADKIRSKKYKVLIDPA
NSVGTLATPIVARELGCKVFTINGNLDPLFSARTPEPTFESLSETAKVAKHLGVDLAVAH
DGDADRAIFIDSMGRVQWGDRSGTLLSYWASIKAPNLPKRIFTAVSSSSLVEEYLKQYNI
EVKWTKVGSVDIAHMLFKEKGVAGFEENGGFMYPPHQAVRDGAMSFALMLEMMASENENS
TELFNRLPVYYLVKTKVRITEKSNINKIYDEIIDKYGKYGNIVTIDGVKIISNDFWLLVR
KSGTEPIIRILVEAKDENKSKELAKELEKLVSELA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttatttggaacggatggaataagaggagttactaatactgaattgcaacca
gaatttgcgttaaaattaggaaaagctataggaacatatttcggtaaaggtgctagaatt
ctaataggcagggatgtaagagctggaggagatatgttacttaaagccgttgagagtgga
ttgttaagtagtggcgtattggtctatgaagctgggatggctcctactccagctttccag
tacggtgtgaaaactttaggatatgacggtggtattataataaccgctagtcataatcca
gctgaatataatggtatcaaagtcctttctccacatggtattgagatatctagggaagac
gaggataaaatagaagatatatactttaataataaatttcatgtagtagaatggaatggt
ttagtaaatgatgtaaaaagagaagataaagttattgaaacttacgtgcaagggatactc
tctcatgttgatgctgataaaattaggagtaaaaagtataaggttctcatagaccctgct
aatagtgtaggtacattggcaacaccaattgttgcgagggagttgggatgtaaagttttt
actatcaatgggaatttagatcctctattttcagctagaacaccagaacccacatttgag
agtcttagtgagactgcaaaagttgctaaacatctgggcgtggatttggcagtagctcat
gatggtgacgcggatagggcaattttcatagactccatggggagagttcaatggggtgat
agaagcggtactttattgtcatattgggcttcgataaaagctccaaatctgcctaagcgt
atatttactgcagtttctagctctagcttagttgaagaatatctaaaacagtacaatata
gaggttaagtggactaaggtaggtagtgtagacattgcacatatgctatttaaggaaaaa
ggagtagcgggatttgaggaaaatggtggatttatgtatcctcctcatcaagcagtaaga
gacggtgcaatgtcattcgctttaatgctggaaatgatggcatctgagaatgaaaactct
actgaactatttaatagactccctgtttattatttagtgaaaacaaaagtaagaattacg
gaaaagagtaatataaataagatttatgacgaaataatagataagtacggaaagtacggg
aatatagttacaatagatggtgttaagattattagcaacgatttctggctcctagttagg
aagagtggtacagagccaataataagaatattagtcgaggcaaaagatgagaataaatca
aaagaattagctaaagagttagaaaagttggtgagtgagttagcgtga

DBGET integrated database retrieval system