KEGG   Sulfolobus islandicus M.16.4: M164_1961Help
Entry
M164_1961         CDS       T00906                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
sid  Sulfolobus islandicus M.16.4
Pathway
sid00860  Porphyrin and chlorophyll metabolism
sid01100  Metabolic pathways
sid01110  Biosynthesis of secondary metabolites
sid01120  Microbial metabolism in diverse environments
Module
sid_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M164_1961
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sid01007]
    M164_1961
Enzymes [BR:sid01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     M164_1961
Amino acid related enzymes [BR:sid01007]
 Aminotransferase (transaminase)
  Class III
   M164_1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ACR42564
UniProt: C4KJ00
Position
complement(1797206..1798486)
Genome map
AA seq 426 aa AA seqDB search
MDKGRCTILNSEELWAQARQLFAGGVNSPVRAAVKPFPFYVERGKGAYIYTVEGNKFIDY
VLGYGPLILGHSPESVKRKIIEQLEKGWLFGTPSKLEIELAKKISSHIPSAQKIRFVNSG
TEATMAAIRLARGYSKRSKILKFSGNYHGAHDYTLVEAGSAATEYNVTTSDGIPMEIMKT
VEICEFNDLDCVDKKLRNEDIAAALLEPIMGNAGVILPEKGFLSGLRELTKSYNSLLIFD
EVITGFRIDIGGAQSYYQIYPDITTLGKIIGGGFPIGAVAGKAEIIDNFTPAGRVFNAGT
FNANPISMIAGIATIEELEKEYPYNIANKASKTLVEELERLLKIKHTINHIGSMFQVFFG
IDKVRNYSDAKRANKEYYIKFHERLLKERVFIPPSQYETIFTSAAHEDDVVNDTIDKLAK
VIGELS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggataagggaaggtgtaccattttgaatagcgaggaactatgggctcaagctaggcaa
ttatttgcgggaggagtaaatagcccagttagagcagcagtaaaaccattcccattttat
gtagaaaggggaaaaggagcttatatttacacggtcgagggtaacaagttcattgactat
gtattgggttacggacctctaattttaggtcactctccagaatccgtaaagagaaaaata
attgagcaattagaaaaaggttggcttttcggaactcctagcaaattagaaatagaatta
gctaaaaaaattagttcacatataccatcagcccagaaaataagatttgtaaatagtgga
actgaggctacaatggctgctataagattagccagaggctattcaaaaaggagtaaaata
ctgaagtttagcggaaattatcatggagctcacgattacacacttgtggaagctggaagt
gctgctacagaatataacgttacaacttctgatggtatcccaatggaaataatgaaaacg
gtagaaatatgcgagtttaatgatcttgattgtgtagataaaaaattaagaaatgaggac
atcgctgcagcactcttagaacctattatgggaaatgctggtgtaatcttacctgaaaag
ggcttcttatctggattaagggaacttacaaagtcctacaattcattattaatcttcgat
gaagttataactggttttagaatcgatataggtggagcgcaatcttactatcaaatttat
ccagacataacaacactaggtaaaatcataggtggtggtttccctataggcgcagtagca
ggtaaagcagaaattattgataactttactcccgctggtagagtatttaatgctggcaca
tttaacgctaaccccatatctatgatagctggaattgctacaatagaagaacttgaaaaa
gaatacccatataatattgcaaacaaagcctctaagactcttgtagaggaattagaaagg
ttgctaaaaataaaacatacaataaatcatattgggagtatgttccaagtatttttcgga
atagacaaggttagaaactattcagatgccaaaagggctaataaagaatattacataaag
tttcatgaaagactattaaaagagagagtcttcattccgccaagtcaatatgagacaatt
ttcacttcagctgcgcatgaagatgatgtagttaacgatactatagataaacttgcaaaa
gtaataggcgaattaagttga

DBGET integrated database retrieval system