KEGG   Sulfolobus islandicus M.16.4: M164_2539
Entry
M164_2539         CDS       T00906                                 
Name
(GenBank) MscS Mechanosensitive ion channel
  KO
K03442  small conductance mechanosensitive channel
Organism
sid  Sulfolobus islandicus M.16.4
Brite
KEGG Orthology (KO) [BR:sid00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sid02000]
    M164_2539
Transporters [BR:sid02000]
 Other transporters
  Pores ion channels [TC:1]
   M164_2539
SSDB
Motif
Pfam: MS_channel_2nd MS_channel_1st FokI_dom_2 DUF5645
Other DBs
NCBI-ProteinID: ACR43131
UniProt: C4KE93
Position
complement(2353319..2354248)
AA seq 309 aa
MALNERRVIAIILTVILAGIAIGGGIFVLSSVFKIIPSYYLLYIYAGIWFIVAVIVSYFI
GSLIRNRLGNVIGYDNASSVSFVVRLIGYIIAFIGFFVLVRVSLGAALAAGGFAGLVLGL
ASQDVLSNIFGGIMLVISRPYKVGDRVTISTWQYGLIAPTYPPKFFSNDFLIPGYTGTVT
DISLLYTTIFTDEQVPVKIPNSIMIQAAIFLHNREERRKVRTKYEVSKDIDHDVLINVLK
EKIKKLDFVIEEPSIKVLETTLNTYILAIDTICKTIYEEPPRSEILKVVMRTVRELQAKT
ASSSGNNNR
NT seq 930 nt   +upstreamnt  +downstreamnt
atggctttaaacgagagaagagtgatagcaattatcttaacagtgatattagctggaata
gcaattggtggaggaattttcgtattatccagcgtatttaaaataattccaagttattat
ctactctatatttatgctggaatttggtttatagtagcagttatcgtttcatacttcata
ggatctctcataaggaataggttaggaaatgtgatagggtacgataatgctagtagtgtt
tcgtttgtagttagacttattgggtatattatagcctttataggattctttgtactggtg
agagtgagtttaggggcagcattagcagcaggcggtttcgctggattggttttaggctta
gcttcacaagatgtgcttagtaacatattcggtgggataatgctagtaatttctagaccg
tataaggtaggagacagagtgacaatatcaacgtggcaatatggtctaatagccccgact
tatcctccaaagttcttctccaatgatttcttgattccaggatatactggtacagtcacg
gacatatccttgctttatactacaatatttactgatgagcaagttccagtaaaaatacca
aatagtataatgattcaagctgcaatcttccttcataacagagaggaaagaaggaaggtt
agaactaagtatgaagtttccaaggatatcgatcatgacgttctaataaacgtccttaag
gaaaagataaaaaaattggatttcgtaatagaagaaccttcaattaaagttctagaaact
acattaaatacatacatattagcaatcgatacgatatgtaaaactatatacgaagaaccc
ccaagaagcgaaatattgaaagttgttatgaggacagtaagagaacttcaagctaagacc
gcatctagtagtggaaacaataatagataa

DBGET integrated database retrieval system