KEGG   Streptococcus intermedius JTH08: SCIM_0185Help
Entry
SCIM_0185         CDS       T02156                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase homolog
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sie  Streptococcus intermedius JTH08
Pathway
sie00900  Terpenoid backbone biosynthesis
sie01110  Biosynthesis of secondary metabolites
sie01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sie00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCIM_0185 (mvaA)
Enzymes [BR:sie01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SCIM_0185 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: BAM22839
Position
complement(216910..218190)
Genome map
AA seq 426 aa AA seqDB search
MKLSWTVFSKKSLQERLKFLQDYHLLNKDNQIGLEHNYTLPLSTADQMSENVIGTLALPY
ALVPDVMVDEQIYQVPFVTEEPSVVAAATFAAKIIKRSGGFKTTVHNRQMIGQVALYQVA
NIEVAIKNIQNHKQELLELANQAHPSIVKRGGGARHLHMEYLNGEAEFLIVYLTVDTQEA
MGANILNTMLEALKTPLEDLSGGKSLMAILSNYATEALVTATCEIDIRFLDRNKSKALDI
AKKIVLASQFAKQDPYRASTHNKGIFNGVDAVVLATGNDWRAIEAGAHAYASRNGTYQGL
TTWSIKEATQTLYGEITLPLPIATKGGSIGLNPTVQVSFDLLKHPTAKELASIIASIGLA
QNFAALKALVSTGIQHGHMKLQAKSLALLAGAQNTEVAPLVSQLISEKNFSLKRAQEILE
DFRQKS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaagttggacagttttttctaaaaaatcgctacaagaacgattaaagttcttg
caagattatcacttgctaaacaaagacaaccaaataggtcttgaacacaattacacactt
cctctttcgacagccgaccaaatgagcgaaaatgtaattggaacacttgctcttccctac
gctcttgttcctgatgtcatggtagatgagcaaatttatcaggttcctttcgtaacagaa
gagccctctgttgttgcagctgccacctttgcagcaaaaatcattaagcgttctggtggc
ttcaaaacaactgttcacaatcgtcaaatgattggacaggttgctctctatcaagtagca
aatattgaagtagctataaaaaatatccaaaaccacaagcaagagttattagaattggcc
aatcaagcacacccatcgattgtcaaacgtggaggtggagcacgccatttgcatatggaa
tatctaaatggtgaagctgaatttctaatcgtctacctaacagttgacacccaagaagct
atgggagccaatatccttaataccatgctagaagcattaaaaacaccattagaagactta
tctggtggtaaaagcttgatggcaattttatcaaattatgcgacggaagccttagtaact
gccacctgtgaaattgatatccgttttcttgaccgaaataagtcaaaagcccttgatatt
gctaagaaaatagtgttagcaagccaatttgccaagcaagatccttatcgcgccagcacc
cacaataaaggcattttcaatggcgttgatgctgttgtattagcgacaggaaatgactgg
cgggcaattgaagcgggagcacatgcctatgctagcagaaatggaacttatcaaggattg
acgacttggtccataaaggaagctactcaaacactctacggagagattactcttccactt
cccatcgctacaaaaggcggttccatcggactcaatcctacggtgcaagttagcttcgat
ttgctaaaacatccaactgccaaagagttagctagtatcattgcgtctatcggtttagca
caaaattttgcagctttgaaagcgttggttagcaccggtattcaacacggacacatgaaa
ctacaagccaagtctctcgctcttttagcaggagcacagaatacagaggttgctcctctg
gtctctcaactcatttccgagaaaaattttagtctcaaaagagcgcaagagattttagaa
gactttcgtcaaaaatcataa

DBGET integrated database retrieval system