KEGG   Streptococcus intermedius JTH08: SCIM_0780Help
Entry
SCIM_0780         CDS       T02156                                 

Gene name
gki
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sie  Streptococcus intermedius JTH08
Pathway
sie00010  Glycolysis / Gluconeogenesis
sie00052  Galactose metabolism
sie00500  Starch and sucrose metabolism
sie00520  Amino sugar and nucleotide sugar metabolism
sie00521  Streptomycin biosynthesis
sie01100  Metabolic pathways
sie01110  Biosynthesis of secondary metabolites
sie01120  Microbial metabolism in diverse environments
sie01130  Biosynthesis of antibiotics
sie01200  Carbon metabolism
Module
sie_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sie_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCIM_0780 (gki)
   00052 Galactose metabolism
    SCIM_0780 (gki)
   00500 Starch and sucrose metabolism
    SCIM_0780 (gki)
   00520 Amino sugar and nucleotide sugar metabolism
    SCIM_0780 (gki)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SCIM_0780 (gki)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SCIM_0780 (gki)
Enzymes [BR:sie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SCIM_0780 (gki)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: BAM23434
Position
907967..908926
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSVKFAILTREGEVQEKWSIKTNILDEGSHIVDDMIESINHRLRLLGL
VAEDFIGIGMGSPGVVDREKGTVIGAYNLNWKTLQPVKEKIEKATGIPFFIDNDANVAAL
GERWKGAGENQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAGGELGHITVDFDQPILCTCG
KKGCLETVASATGIVNLTRRYADEYAGDAELKKLIDNGEDVNAKIVFDLAKSGDELALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLDGVRKVYEENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaatcattgggattgacctaggtggcacatcggttaagtttgcgattcta
acccgagagggagaagttcaagaaaaatggtctattaagacaaatattttagatgaaggc
agtcatattgttgatgatatgattgaatctatcaatcatcgcttgcgactattgggactt
gtggcagaagatttcattggaattggtatgggttcacctggtgttgtagatcgtgaaaaa
gggacggttattggggcttataatctcaattggaaaactttacaacctgtaaaagaaaaa
attgagaaagcaactggtattcctttctttattgataatgacgcaaatgtagctgccctt
ggcgaacgttggaaaggtgctggtgaaaatcagcccgatgttgtgtttatgactctagga
acaggagtcggtggtggtattgtcgcggaaggtaaactgctgcatggtgtagctggagca
ggaggagaattggggcatattacagttgattttgatcaaccaatcctttgtacttgtggc
aagaaaggttgtttagaaacagtagcttctgcaacaggtattgttaatttaacgcgtcgc
tatgctgatgaatatgctggtgatgcagagctaaaaaaactgattgataacggcgaagat
gttaatgcaaaaatagtctttgacttagctaaatctggagacgaattagctctcattgtt
tatcgaaatttttctcgttaccttggtattgcctgtgcaaacattggatcaatcttaaat
ccatcaacgattgttattggtggtggtgtctctgctgcaggagaatttttactagacggt
gttcgtaaggtttatgaagaaaattctttcccacaagtgcgtacttcgacaaagctggca
cttgcaacgcttggaaatgatgcaggtgtcattggagcggcttctttagttcttcaataa

DBGET integrated database retrieval system