KEGG   Streptococcus intermedius JTH08: SCIM_1363Help
Entry
SCIM_1363         CDS       T02156                                 

Gene name
basA
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sie  Streptococcus intermedius JTH08
Pathway
sie00480  Glutathione metabolism
sie00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SCIM_1363 (basA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCIM_1363 (basA)
Enzymes [BR:sie01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SCIM_1363 (basA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: BAM24017
Position
1550099..1550575
Genome map
AA seq 158 aa AA seqDB search
MTKIYDFSIFDQNNRSISLEIYKGNVLLIVNTATGCGLTPQYKGLQHLYTRYQNQGFEIL
DFPCNQFMGQAPGTAEEINRFCSLHYQTTFPRFAKVKVNGKEADPLYIWLKEQQAGPLGK
RIEWNFTKFLINREGQVVKRFSSKAEPKEIEESLQKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatatatgatttttccattttcgatcagaataatcgatctatctccctagaa
atttataaagggaatgttctgcttattgtcaatactgcaacaggttgtggcctgaccccc
caatataagggactacaacacctctacacccgctatcaaaaccagggctttgaaatcctc
gactttccttgtaatcaatttatggggcaggcaccaggtacagcagaagaaatcaatcgt
ttttgcagcctccactaccaaactacttttccacgttttgctaaagttaaagtcaatggt
aaggaagcagatcctctctatatctggctaaaagaacaacaagctggccccctcggaaaa
agaatcgaatggaattttactaaattcttaataaaccgagaagggcaagttgtgaaacga
ttttcatctaaagcagaacctaaagagattgaggaaagtttacaaaagctattataa

DBGET integrated database retrieval system