KEGG   Streptococcus intermedius JTH08: SCIM_1522Help
Entry
SCIM_1522         CDS       T02156                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sie  Streptococcus intermedius JTH08
Pathway
sie00040  Pentose and glucuronate interconversions
sie00052  Galactose metabolism
sie00500  Starch and sucrose metabolism
sie00520  Amino sugar and nucleotide sugar metabolism
sie01100  Metabolic pathways
sie01130  Biosynthesis of antibiotics
Module
sie_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SCIM_1522 (galU)
   00052 Galactose metabolism
    SCIM_1522 (galU)
   00500 Starch and sucrose metabolism
    SCIM_1522 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SCIM_1522 (galU)
Enzymes [BR:sie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SCIM_1522 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: BAM24174
Position
1738845..1739741
Genome map
AA seq 298 aa AA seqDB search
MTQVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIKDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKSDLLKLVDETTGIGLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNDKAVPLTKQLMNDYKETHASTIAVMKVPHDDVSSYGVIDPQG
EGVNGLYSVETFVEKPKPEDAPSDLAIIGRYLLTPEIFSILETQAPGAGNEIQLTDAIDT
LNKTQRVFAREFTGDRYDVGDKFGFMKTSIDYALKHPQVKDDMKQYIIDLGKKLDKKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtaagaaaagctgttattcctgctgctggacttggaactcgtttcttgcca
gccacaaaagcgctcgccaaagaaatgctacctattgttgacaaaccaactattcaattt
attgtcgaagaagcattaaaatctggtatcaaagacatcttggttgtaaccggaaaatct
aaacgatctattgaagaccactttgattcaaactttgaattggagtataacctcaaagaa
aaagggaaatctgaccttttaaaactcgtagatgaaacaactggtatcggccttcatttc
attcgccaaagccatccacgcggtcttggagatgccgttttacaagccaaagctttcgtt
gggaatgaaccctttgtcgttatgttaggtgatgatctgatggacattacaaacgacaaa
gcagttccgctaaccaaacagttaatgaatgattacaaagaaacacatgcatcaaccatt
gctgtcatgaaagtaccacacgatgacgtttcgtcttatggtgttattgacccgcaaggt
gaaggagtaaatggactctacagcgtggagacctttgttgaaaaaccaaaaccagaagac
gcaccaagtgaccttgcgattattggtcgctaccttttgacaccagaaatcttctccatt
ttggaaacacaagctccaggtgctggaaatgaaatccaactgacagatgccattgatact
ctcaataaaacacaaagagtatttgcccgtgaattcacaggtgatcgttatgacgttggt
gacaaatttggctttatgaaaacatctattgattacgccctcaaacatccccaagtaaaa
gatgacatgaaacaatatatcatcgatttgggtaaaaaattagataagaaaaactaa

DBGET integrated database retrieval system