KEGG   Streptococcus infantarius: Sinf_0465Help
Entry
Sinf_0465         CDS       T01765                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase (alpha subunit)
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sif  Streptococcus infantarius
Pathway
sif00260  Glycine, serine and threonine metabolism
sif00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sif01100  Metabolic pathways
sif01110  Biosynthesis of secondary metabolites
sif01130  Biosynthesis of antibiotics
sif01230  Biosynthesis of amino acids
Module
sif_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinf_0465 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinf_0465 (trpA)
Enzymes [BR:sif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sinf_0465 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: AEZ61818
UniProt: H6P8C8
Position
489056..489838
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLQKIKASGKGIFVPYIMAGDHDKGLDGLFETIDLLENSGASAIEVGIPWSDP
VADGPVIELAGQRSLAKGVNLTGIVEKLQEKTVEVPLVIMTYINPVYQYGIEKFVKDLAN
TSVKGLIIPDLPHEHENLIKPYLDNTDIALVPLVSLTTGIERQKTLCQNAEGFIYAVAIN
GVTGKTGNYRDDLDKHLANLEAVADIPVLTGFGVSTKADIERFNKVSDGVIVGTKIVRDL
HGGKADDVAAFVTYGSNYQK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacacttacaaaacatcttcaaaagattaaagctagcggcaaaggaattttt
gttccttacatcatggcaggtgaccatgataaaggtcttgatggtttatttgagacgatt
gatttattggaaaatagcggagcttctgccattgaagtggggattccatggtctgacccc
gtcgctgatggcccagttattgaattagctggtcaaagaagtcttgctaaaggcgttaat
ttgacaggaatcgttgaaaaattacaagaaaaaacagtcgaagtgcctttggtcattatg
acttacatcaatcctgtttatcaatatggcattgaaaaatttgttaaagatttggccaat
acctctgttaaaggtttgattattcctgacttgccacatgagcatgaaaatcttatcaag
ccataccttgataatacagatattgcccttgttccactggtcagcttgactactggcatt
gaacgtcagaaaactttgtgtcaaaacgctgaaggctttatctatgcggttgctatcaac
ggtgttacaggtaaaactggtaattatcgtgatgatttggataaacatttggcaaatctt
gaagctgttgctgacattccagtattaacgggatttggagtgtcaacaaaagctgatatc
gagcgttttaataaggtgtcagatggcgtcattgtcggaactaaaattgttcgagattta
cacggaggtaaagcagatgacgtcgcagcatttgtaacatatggctcaaattatcaaaaa
taa

DBGET integrated database retrieval system