KEGG   Streptococcus sp. I-G2: N596_05320Help
Entry
N596_05320        CDS       T02879                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sig  Streptococcus sp. I-G2
Pathway
sig00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    N596_05320
Enzymes [BR:sig01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     N596_05320
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     N596_05320
    1.1.1.-  
     N596_05320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 17316300
NCBI-ProteinID: AGY40222
UniProt: U5PDE8
Position
complement(1074654..1075694)
Genome map
AA seq 346 aa AA seqDB search
METMKAARWHGKKDVRIEEVEVPEVQPHQVKVAVKFTGICGTDLHEYLDGPIFIPTEEHV
YSGQKAPVTLGHEFAGEIVEVGSNVTRVKVGDRVTIEPILAKHNLIGDYNLDPNLNFVGL
AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSALKTGDTAVIFGLGP
IGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEEGESIVEAIHRLTDGGADV
SYEVTGVPVVLGQALAAVHKAGECMVVSIWEREASINPNEFAIQEKTLKGIIAYRHIFPK
VLELMEQGYFSAEKLVTKKIKLENIVEEGFVELTQDKAQIKILVEP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaatgaaagctgcccgctggcatggcaaaaaggacgttcgtatcgaggaagtg
gaagtcccagaagtacaacctcatcaagtaaaggttgcggtcaaattcacgggaatctgt
ggaacagacttgcatgaatacttggatgggccaatcttcattccaacagaagagcatgtt
tattctggtcaaaaagcacccgtgaccctcggtcatgagtttgctggagaaattgttgag
gttggaagcaatgtgactcgtgtcaaagtcggggatcgtgtaacaatcgaaccaattttg
gcaaaacacaacttaattggtgattataacctcgatccaaacttgaattttgttggcctt
gctgcagatggaggttttgctaaatattgtgtcctagatggagatttggtccatgtgatt
ccagatagcttgagctatgaacaagctgctcttacagaacctgctgctgttgccgtttat
gcagttcgtcagtctgctttgaaaactggggatacagctgttatctttggtttgggccca
atcggtcttttgatcgtggaagctctccgtgcagctggggcatcgaaaatttatgcagtt
gaattgtctcctgaacgccaagctaaggctgaagaattgggtgccattgtggttcgccca
gaagaaggtgaatcaatcgttgaagccattcatcgtttgacggatggtggagcggatgtt
tcttatgaagtgacaggggttcctgttgttcttggacaagctttggcagctgtgcataag
gctggtgagtgtatggttgtttctatttgggaacgtgaagccagcatcaatccaaatgaa
ttcgccattcaagaaaagaccctcaaagggattatcgcttatcgtcacatcttccctaaa
gtattggaattgatggaacaaggctacttctctgctgaaaaattggtgaccaagaaaatt
aaattggaaaatatcgttgaagaaggatttgttgaattaacacaagataaggcccaaatt
aagattttggttgagccatga

DBGET integrated database retrieval system