KEGG   Streptococcus sp. I-G2: N596_05570Help
Entry
N596_05570        CDS       T02879                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
sig  Streptococcus sp. I-G2
Pathway
sig00670  One carbon pool by folate
sig01100  Metabolic pathways
sig01120  Microbial metabolism in diverse environments
sig01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sig00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    N596_05570
Enzymes [BR:sig01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     N596_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 17316350
NCBI-ProteinID: AGY40269
UniProt: U5P990
Position
complement(1133077..1133952)
Genome map
AA seq 291 aa AA seqDB search
MTKQTPSLSFEVFPPNPEVGNAKLLRALENMQELAPHFISVTASNNKYNIKETTVALANH
IQNELSIPTIAHLPAIYLSKEKVADTLHDLDQVGVHRILALRGDIIPGVEPLKDFRYATD
LIEFIKTEAPHFDVIGACYPEGHPDSPNQISDIQNLKKKVDAGCSSLVTQLFFDNERFYD
FQDKCILAGIDVPIHAGVMPILNRNQALRLLKTCENVHIPRKFKAILDKYEHDPESLRAA
GLAYAVDQIVDLVTQDVAGVHLYTMNNEDVAYHVHHATKALFDHQPNLEVI
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcaaacaccgtcgctctcctttgaggttttccctccaaatcctgaagtaggc
aatgccaagctcttacgtgccttggaaaatatgcaggaattagctcctcactttatcagt
gtgacagctagtaataacaaatacaatatcaaagagacgacggttgccttagccaatcat
attcaaaatgaattgtctattccgaccattgcccacttgcctgccatctatctgagtaag
gaaaaagtggcagatacccttcatgacttagatcaagtgggagttcatcggatcttggcc
cttcgtggagatattattccaggtgtggagcctctgaaagactttcgttatgcaacggat
ttgattgaatttattaaaacagaagctcctcattttgatgtaatcggtgcttgttaccca
gaagggcacccagattctccaaatcaaatttcagatattcaaaatctgaaaaagaaagtg
gatgctggatgttcaagcctagtgactcagcttttctttgacaatgagcgtttctacgat
tttcaagataagtgtatcttagcgggaattgatgttcccattcatgcaggggtgatgcca
attcttaacagaaaccaggcccttcgcttgttgaaaacttgtgaaaatgttcatatccca
cggaagttcaaagccatccttgataagtatgagcatgatccagaatcccttcgtgcagct
ggtttagcttatgcggtagatcaaatcgtagatttggtcacacaagatgttgcaggtgtc
catctctataccatgaacaatgaagatgtagcctatcatgtccatcatgcaacaaaagct
ttatttgatcatcaaccaaacttagaggtgatctaa

DBGET integrated database retrieval system