KEGG   Streptococcus sp. I-G2: N596_08065Help
Entry
N596_08065        CDS       T02879                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sig  Streptococcus sp. I-G2
Pathway
sig00450  Selenocompound metabolism
sig00970  Aminoacyl-tRNA biosynthesis
sig01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sig00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    N596_08065
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    N596_08065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sig01007]
    N596_08065
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sig03016]
    N596_08065
Enzymes [BR:sig01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     N596_08065
Amino acid related enzymes [BR:sig01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   N596_08065
Transfer RNA biogenesis [BR:sig03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    N596_08065
 Prokaryotic type
   Other AARSs
    N596_08065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_bind
Motif
Other DBs
NCBI-GeneID: 17316845
NCBI-ProteinID: AGY41054
UniProt: U5PBH8
Position
1661985..1662509
Genome map
AA seq 174 aa AA seqDB search
MDFDLENLTLAGFPENVTVVAKGTPIFPRLDMDEEIAYIQSQMTAGKTEEKEWIPEEVEL
KSEKDEIKFEDFDKVEIRVAEVKEVERVEGSDKLLRFRLDAGDGEDRQILSGIAKFYPNE
QELVGKKLQIVANLKPRKMMKKYVSQGMILSAEHGDQLTVLTVDPSVLNGSIIG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ttggacttcgatcttgagaacttgaccctagcaggcttccctgaaaatgtcacagtagtt
gccaaaggaactccaatcttccctcgcctggatatggatgaagaaattgcctacatccaa
tctcaaatgactgctggtaaaacagaagaaaaagaatggattccagaagaagtggaactc
aagtctgaaaaagatgagattaaatttgaagactttgacaaggtcgaaatccgtgtggca
gaggtcaaagaagttgaacgcgtcgaaggatctgacaaattgcttcgcttccgcctagat
gcaggagatggcgaagaccgtcaaatcctctctggtatcgcaaaattctatccaaatgaa
caagaattggtcggcaagaaactccaaatcgtggccaacctcaaaccacgtaagatgatg
aagaaatatgtcagccaaggcatgattctttctgcagaacacggggatcaattaacagtc
ttaaccgttgatccatctgtgctaaatggcagcatcattggctaa

DBGET integrated database retrieval system