KEGG   Sulfolobus islandicus HVE10/4: SiH_0375Help
Entry
SiH_0375          CDS       T01952                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
sih00010  Glycolysis / Gluconeogenesis
sih00020  Citrate cycle (TCA cycle)
sih00620  Pyruvate metabolism
sih00633  Nitrotoluene degradation
sih00640  Propanoate metabolism
sih00650  Butanoate metabolism
sih00680  Methane metabolism
sih00720  Carbon fixation pathways in prokaryotes
sih01100  Metabolic pathways
sih01120  Microbial metabolism in diverse environments
sih01130  Biosynthesis of antibiotics
sih01200  Carbon metabolism
Module
sih_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SiH_0375
   00020 Citrate cycle (TCA cycle)
    SiH_0375
   00620 Pyruvate metabolism
    SiH_0375
   00640 Propanoate metabolism
    SiH_0375
   00650 Butanoate metabolism
    SiH_0375
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiH_0375
   00680 Methane metabolism
    SiH_0375
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SiH_0375
Enzymes [BR:sih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SiH_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Phage_TAC_9
Motif
Other DBs
NCBI-ProteinID: ADX81745
UniProt: F0NN62
Position
complement(325916..326464)
Genome map
AA seq 182 aa AA seqDB search
MTLIELALRGRGGQGIVTAGELVTKAMVLEDKYAQSIPFFGGERRGAPVVSFLRLSDKPI
LLHREVYNPDGVAIFDTSLIQIINVTEGLKENGFLLLNTNTPKRIWKSEYIVDATSIAKE
LGLVVAGWAVVNTAMIGALVKILGQPSLHSLEETVKEEFPGKIGELNAEAVEMGYKGVKR
VD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgactcttattgaattagctttaaggggaaggggagggcaaggaatagttactgctggg
gaacttgttacaaaggccatggttttagaggataaatacgcccaatccataccctttttc
ggtggggaaaggagaggagctccagtcgtatcatttctaaggctgtcagataagccgata
cttttacatagagaagtttacaatccagacggtgttgcaatatttgatacgtcactcatt
caaataattaacgttacagagggactcaaagaaaacggtttcttactactaaacacaaat
acgcctaagagaatttggaaaagtgagtatattgttgacgctacaagtattgctaaagaa
ttagggctagtcgtagctggatgggctgttgttaataccgcgatgataggagctttagtg
aaaatcttggggcaaccttccttacactcgttggaagagactgtaaaggaagaattcccg
ggaaagataggggaactcaatgcggaagcggttgaaatgggatataagggggtgaaaagg
gttgattaa

DBGET integrated database retrieval system