KEGG   Sulfolobus islandicus HVE10/4: SiH_1048Help
Entry
SiH_1048          CDS       T01952                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
sih00260  Glycine, serine and threonine metabolism
sih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sih01100  Metabolic pathways
sih01110  Biosynthesis of secondary metabolites
sih01130  Biosynthesis of antibiotics
sih01230  Biosynthesis of amino acids
Module
sih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SiH_1048
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SiH_1048
Enzymes [BR:sih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SiH_1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADX82397
UniProt: F0NPD3
Position
complement(1062509..1063798)
Genome map
AA seq 429 aa AA seqDB search
MAMRIRIDLPQDEIPTQWYNILPDLPEELPPPQDPTGKSLELLKEVLPSKVLELEFAKER
YVKIPDEVLERYLQVGRPTPIIRAKRLEEYLGNNIKIYLKMESYTYTGSHKINSALAHVY
YAKLDNAKFVTTETGAGQWGSSVALASALFRMKAHIFMVRTSYYAKPYRKYMMQMYGAEV
HPSPSDLTEFGRQLLAKDPNHPGSLGIAISDAVEYAHENGGKYVVGSVVNSDIMFKTIAG
MEAKKQMELIGEDPDYIIGVVGGGSNYAALAYPFLGDELRSGKVRRKYIASGSSEVPKMT
KGVYKYDYPDTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPTLSLLMSKGIVQARDY
SQEESFKWAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGERKTVLVSFSGHGLLDLG
NYASVLFKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagaataagaatagatttgcctcaagatgaaatacccacacaatggtataat
atcctaccagacttaccggaggaactacccccgccacaagatcccactggcaaatcccta
gaactattgaaggaagttttaccgagcaaggtgctggagttagagttcgctaaggaaaga
tacgtaaaaattccagatgaggttctggagagatatttacaagttggaagaccgactcca
ataattagggcaaaaaggttagaggagtacttaggaaataatatcaaaatctatctgaag
atggagagctacacttacactggttctcacaaaatcaacagtgccttagcacatgtatat
tacgctaaattggataacgcgaaattcgttacgacagaaactggagctggtcagtgggga
tcatcagttgcactagcctcagccctatttaggatgaaagcacacatatttatggttagg
actagctattatgcaaagccttacagaaaatatatgatgcagatgtatggagcggaagtt
catccttctccttcagatttaacagaattcggtagacaattattagctaaggaccctaat
catcctggatctttaggcatcgcaataagtgatgcagtagaatatgctcatgaaaacggt
ggaaaatatgttgtaggtagtgtggtaaattcagatataatgtttaaaacgattgccgga
atggaggctaagaagcaaatggaactgattggtgaagatccagattacattataggagta
gtaggagggggatcaaattacgcagcattagcttatccattcttaggagatgagctgagg
agtggaaaggttaggaggaagtatattgcctctggatcctcagaagttccaaaaatgact
aagggtgtttataaatacgattatccagacactgcgaaattgttgccaatgctaaaaatg
tacacaatagggtcggacttcgtaccacctccagtttatgcaggtgggctaagatatcat
ggagtagccccaactctcagtctattaatgagcaagggaattgtacaagcaagagattac
tctcaagaggagtcgttcaaatgggctaaattattctcagaactggagggatatatacca
gctccagagacttctcacgcattgccaatattggctgaaatagctgaagaggctaagaag
agcggagaaaggaagacagtactggttagcttctctgggcatggactactagatttgggc
aactacgcctcagtgttatttaaggagtag

DBGET integrated database retrieval system