KEGG   Sulfolobus islandicus L.D.8.5: LD85_0158Help
Entry
LD85_0158         CDS       T01158                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IIA
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00627  Aminobenzoate degradation
sii01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sii00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LD85_0158
Enzymes [BR:sii01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LD85_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase PGP_phosphatase Hydrolase_3 YhfZ_C QSOX_Trx1
Motif
Other DBs
NCBI-ProteinID: ADB85958
UniProt: D2PEK2
Position
134758..135552
Genome map
AA seq 264 aa AA seqDB search
MSTLNDYQLIISDVDGVIVREGEPIWENIQALRNIQNNGVKVIFVTNNSGFSRILLSRQL
SYLGLKVTPDMIITSGLAAAIYMKEKLNVKSVFAVGEEGLIEELKNHGFLVFSSVESERN
LPDAVVMGLDRLSTYDKLSLAMRCISKGSKFIVTNMDRLWPAKDGLKLGAGALASSIIYA
LRRDPDFIAGKPNTWIIEIAMRISSVKKLDKILVIGDQIETDIQMGYNIGADTALVLTGI
STVDDVDRSSVKPKYVVNSLLDLL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacttaatgactatcaattaataataagtgatgtagatggggtaatagtaaga
gaaggggaaccaatatgggaaaatatacaagcgttaaggaatatacaaaataatggagtt
aaggttatatttgtaactaataattccggttttagtaggatcttattatctagacagctg
tcctatttaggccttaaggttactccagatatgataattacaagtggtttggctgctgca
atttacatgaaggagaagcttaatgttaagtctgtattcgcagtaggcgaagaggggctt
attgaagaattgaaaaatcatggtttcttagtattctctagtgtggaatcagagagaaac
ttaccagatgccgtagtgatgggactggataggttaagtacgtatgataaactatcgtta
gccatgaggtgtataagcaagggatcgaaattcatagtaacaaatatggatagactttgg
ccagctaaggatgggttaaagttgggtgctggggcgttggctagttctataatttacgcc
ttgagaagggatccagactttatagcagggaaacctaacacctggataatagaaatagcc
atgcgaatttcaagtgttaagaagttagataaaattctagttataggggatcagatagag
actgatatccaaatgggatacaatataggtgctgatacagcattagttttaactggtata
tcaactgttgacgatgttgataggagtagtgttaagccgaaatacgtagtaaatagttta
ttagaccttttgtga

DBGET integrated database retrieval system