KEGG   Sulfolobus islandicus L.D.8.5: LD85_1205Help
Entry
LD85_1205         CDS       T01158                                 

Definition
(GenBank) hypothetical protein
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00260  Glycine, serine and threonine metabolism
sii00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sii01100  Metabolic pathways
sii01110  Biosynthesis of secondary metabolites
sii01130  Biosynthesis of antibiotics
sii01230  Biosynthesis of amino acids
Module
sii_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LD85_1205
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LD85_1205
Enzymes [BR:sii01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LD85_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADB86876
UniProt: D2PJC3
Position
complement(1051181..1052470)
Genome map
AA seq 429 aa AA seqDB search
MAMRIRIDLPQDEIPTQWYNILPDLPEELPPPQDPTGKSLELLKEVLPSKVLELEFAKER
YVKIPDEVLERYLQVGRPTPIIRAKRLEEYLGNNIKIYLKMESYTYTGSHKINSALAHVY
YAKLDNAKFVTTETGAGQWGSSVALASALFRMKAHIFMVRTSYYAKPYRKYMMQMYGAEV
HPSPSDLTEFGRQLLAKDSNHPGSLGIAISDAVEYAHKNGGKYVVGSVVNSDIMFKTIAG
MEAKKQMELIGEDPDYIIGVVGGGSNYAALAYPFLGDELRSGKVRRKYIASGSSEVPKMT
KGVYKYDYPDTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPTLSLLMSKGIVQARDY
SQEESFKWAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGERKTVLVSFSGHGLLDLG
NYASVLFKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagaataagaatagatttgcctcaagatgaaatacccacacaatggtataat
atcctaccagacttaccggaggaactacccccgccacaagatcccactggcaaatcctta
gaactattgaaggaagttttaccgagcaaggtgctggagttagagttcgctaaggaaaga
tacgtaaaaattccagatgaggttctggagagatatttacaagttggaagaccgactcca
ataattagggcaaaaaggttagaggagtacttaggaaataatatcaaaatctatctgaag
atggagagctacacttacactggttctcacaaaatcaacagtgccttagcacatgtatat
tacgctaaattggataacgcgaaattcgttacgacagaaactggagctggtcagtgggga
tcatcagttgcactagcctcagccctatttaggatgaaagcacacatatttatggttagg
actagctattatgcaaagccttacagaaaatatatgatgcagatgtatggagcggaagtt
catccttctccttcagatttaacagaattcggtagacaattattggccaaagactccaat
catcctggatctttaggcatcgcaataagtgatgcagtagaatatgctcataaaaacggt
ggaaaatacgttgtaggtagtgtggtaaattcagatataatgtttaaaacgattgccgga
atggaggctaagaagcaaatggaactgattggtgaagatccagattacattataggagta
gtaggagggggatcaaattacgcagcattagcttatccattcttaggagatgagctgagg
agtggaaaggttaggaggaagtatattgcctctggatcctcagaagttccaaaaatgact
aagggtgtttataaatacgattatccagacactgcgaaattgttgccaatgctaaaaatg
tacacaatagggtcggacttcgtaccacctccagtttatgcaggtgggctaagatatcat
ggagtagccccaactctcagtctattaatgagcaagggaattgtacaagcaagagattac
tctcaagaggagtcgttcaaatgggctaaattattctcagaactggagggatatatacca
gctccagagacttctcacgcattgccaatactggctgaaatagctgaagaggctaagaag
agcggagaaaggaagacagtactggttagcttctctgggcatggactactagatttgggc
aactacgcctcagtgttatttaaggagtag

DBGET integrated database retrieval system