KEGG   Sulfolobus islandicus L.D.8.5: LD85_1820Help
Entry
LD85_1820         CDS       T01158                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
sii  Sulfolobus islandicus L.D.8.5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ADB87478
UniProt: D2PCQ8
Position
complement(1579497..1580669)
Genome map
AA seq 390 aa AA seqDB search
MSVLRNCEYSFLSISFIISFSLQLMGAYLILWFYSIGLSFTEIGLITSIYMILTLPVDIP
SSALADKYGRLKIFSIGTLIYSLGLISLSASSSPIFVFLSYGIMGIGLGIYSNTLEAWVV
DSLNSREKLPKIFSRQQIANGIAGFLGNAVASVLILLYHKLNFPILIAGLVMILSVIIAL
LSEDNKGGKTTTLPAKRIVKEGVKHVASERALLALLTSSIFTVFPLVAWMQFVSPYVVNV
LGLPQKYWGFILSAYFLTVALGGYINEKLLKKVNHRLITIFSVFLLSLFVLTLSISNLSL
ILFLLFGLSLIYPIRSSNIISWENELIPSNYRATVLSSLSFIIRIIYILVPPLVGYLINT
YGYSLTYIIVGLISLIGVIPLVIAYEVKTF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtactgagaaattgtgaatactcgtttctttcaatttcattcataatttcattc
tcattacaattaatgggggcttatttaatactgtggttttatagtataggactctctttt
actgaaataggattaattacttcaatatatatgattttaacattaccagtagatataccc
tcttctgcacttgcagataagtatggtaggcttaaaattttctcaataggcacgttaatt
tacagtctaggattaattagcttgtcagcttcctcatcgccaatttttgtgtttttatct
tacggaataatgggtataggattaggcatttactcgaataccttagaagcctgggtcgtc
gactctttaaattcacgtgagaagttgcctaaaattttttcaaggcaacagatagcaaat
ggaattgcaggatttttaggaaatgcagtcgctagcgttttaatacttttatatcataag
ttaaattttccaattttgatagctggattagtaatgatactaagcgtaattattgcacta
cttagtgaagataataagggaggaaagacaacgacattacccgccaaaaggattgtgaaa
gaaggtgtgaaacacgtggcaagtgaaagagcattattagccttactgacttcatcaatt
tttactgtttttccgttagtagcatggatgcagttcgtttcaccgtatgtagtaaatgtt
ttaggattaccccagaagtattggggatttattttgtcagcctatttcttaacggttgct
ttaggaggttatataaacgagaagttattgaaaaaggtaaatcatagattaattaccata
ttctcagtattcttactatcactctttgtattaacgctctcaattagcaacttaagtctt
atattattccttctgtttggtttgtcactgatttaccctatccgctcgtcaaatataatc
tcatgggagaacgaattaatacctagcaattatagagccactgtactctcctccctttca
tttataattaggataatatatatacttgtacctccactagtagggtatctaattaatact
tatgggtacagtttaacatacataattgtaggattaatttcgttaataggagttatacca
ttggtgattgcttatgaagttaaaacattctaa

DBGET integrated database retrieval system