KEGG   Sulfolobus islandicus L.D.8.5: LD85_2759Help
Entry
LD85_2759         CDS       T01158                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sii  Sulfolobus islandicus L.D.8.5
Pathway
sii00010  Glycolysis / Gluconeogenesis
sii00620  Pyruvate metabolism
sii00640  Propanoate metabolism
sii00680  Methane metabolism
sii00720  Carbon fixation pathways in prokaryotes
sii01100  Metabolic pathways
sii01110  Biosynthesis of secondary metabolites
sii01120  Microbial metabolism in diverse environments
sii01130  Biosynthesis of antibiotics
sii01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sii00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LD85_2759
   00620 Pyruvate metabolism
    LD85_2759
   00640 Propanoate metabolism
    LD85_2759
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    LD85_2759
   00680 Methane metabolism
    LD85_2759
Enzymes [BR:sii01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LD85_2759
Lipid biosynthesis proteins [BR:sii01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LD85_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADB88366
UniProt: D2PH01
Position
2382155..2384155
Genome map
AA seq 666 aa AA seqDB search
MSVTWALPFDQKINPKLNLNRLVSITTYKEIHSQTVKDYKQFWASVASEIDWFKPWEKTL
DDSNPPFYKWFVGGELNASYLTVDRHVKSWRKNKVAIIWEGEPVDEKGNPKEVRKLTYYD
LYREVNRVAYLLKEKYGLKKGDAIAIYLPMIPELPIFMLAAARIGVVFTVVFSGFSADAL
ASRINDAEAKLLITADGGWRRGKVVDLKGIVDKALEKTPTIKDVIVVRRIGNKVNMVEGR
DKYFDEVIKDIPQNVYVEPERMKSEDPLYILYTSGTTGKPKGIVHDIGGYMTLLHATMKW
VFDIRDDDIYWCTADIGWVTGHSYIVFGPLMEGATEIMYEGALDYPQPDRWVSIIERYGI
TILYTSPTAIRSFMKYGDNWVKAHITSTVRLMHSVGEPINPEAWEWLWKLVGREEVPFGS
TWWMTETGGILISHLPGLYLVPMKAGTNGPPILGIEPDVVNEDGKQVNLEERGYLVIKNP
WPGMPLTIYKDPERYVKVYWSRFPGMFYVGDYAVKDKDGYFWILGRADEVIKVAGHRLGT
YELESALIEHPAVAEAAVIGVPDPVKGEVPYAFVILRQGYTPNTQLSQEILKTVRDKVGP
IATIDKIFFVGKLPKTRSGKIMRRVVRAVATRAEVGDITTLEDEASVEEIKKALEEFKAE
FEKINK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaacgtgggctctaccttttgatcaaaagataaacccaaaactgaatttaaat
aggctagtaagtataactacgtataaagagattcacagccaaacggtaaaagattacaaa
caattttgggcatctgtagcctcggaaattgactggttcaaaccatgggagaaaacacta
gacgatagtaatcctccattctataagtggttcgtaggtggagagcttaacgcctcttat
ctaactgtagataggcacgttaagagctggaggaagaataaggttgccataatatgggaa
ggagaaccagtggacgagaagggaaacccaaaggaggttaggaagttaacatattacgat
ctatatagggaagttaatagagtagcctatctcttgaaggagaaatacgggttaaagaaa
ggtgatgcaatagcgatttaccttccaatgataccggaattaccaatattcatgttagct
gctgctaggatcggagtagtctttacggtggtgttctcaggatttagcgctgacgcattg
gcaagtaggattaatgacgccgaagccaagttactaattaccgcagatggtggatggaga
aggggtaaagttgttgacttaaagggaattgtagataaggctttggagaagaccccaaca
ataaaggatgtaatagtagttagaaggataggtaataaggtcaacatggttgaaggtagg
gataagtactttgatgaagtaatcaaggacattccacaaaatgtttacgttgaaccagaa
aggatgaaatctgaagacccgttatatatactctacacctctggaaccactggaaaacct
aagggtatagtccacgatattggagggtatatgacattattacacgctacaatgaagtgg
gtattcgatataagggatgacgacatttactggtgtaccgcagatataggatgggttact
ggacactcttacattgtgtttggaccattaatggaaggagcaactgaaataatgtatgaa
ggagccttggattatccacaaccggataggtgggtatcgataattgaaaggtatgggatc
acaatcctttatacctcacccactgcaattagaagcttcatgaaatatggtgataattgg
gttaaggctcacattacctccactgttaggctaatgcattctgtaggtgaaccaataaat
ccggaagcttgggagtggctatggaaattagtcggtagagaggaggtaccatttggaagc
acttggtggatgactgagactggaggtattctaatatctcatttaccaggattgtatctt
gtgccaatgaaagctgggacaaatggcccaccaatattgggaattgagccagatgtagtt
aatgaagatgggaaacaagttaaccttgaggaaagaggatatcttgttataaagaatccg
tggcctggaatgccattaacaatttacaaggatcctgaaagatacgtgaaggtgtattgg
agtagattccctggaatgttctatgttggtgattacgctgttaaggacaaggatggatac
ttctggatattagggagggctgatgaagttataaaggtagctgggcataggttaggtaca
tatgagttagaatcagctttaattgagcatcctgcagttgcggaagcagcggtaattgga
gtcccagacccagttaagggagaggtgccttatgcgtttgtaattttgaggcaaggttat
acacctaatacgcagctttcacaagagatactgaagacggtaagagataaggtgggacct
atagctactatagataagatattcttcgtgggtaagttgcctaaaacgagaagtggaaag
ataatgagaagagttgtaagggctgttgcaactagggcagaagtgggagatataactaca
ctggaggatgaggcttctgtagaggagattaaaaaagctttagaggagtttaaggcagag
tttgaaaagattaacaaataa

DBGET integrated database retrieval system