KEGG   Scardovia inopinata: SCIP_0101Help
Entry
SCIP_0101         CDS       T03977                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sij  Scardovia inopinata
Pathway
sij00561  Glycerolipid metabolism
sij00640  Propanoate metabolism
sij01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sij00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SCIP_0101
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SCIP_0101
Enzymes [BR:sij01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SCIP_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: BAR06168
Position
128222..129346
Genome map
AA seq 374 aa AA seqDB search
MRTVLCSPGTYVQQEGAIKTLAAEYAAVSPSEGRNGAYIIVDSVIDGLYHDDIVSSFTSG
SDDGQATHVKYKLVLFGGECSDAEIQKHVAQLEDADTVIGIGGGKTLDTAKAVGYYGKRQ
AIIVPTAASSDAPCSRLSVVYTDDSQFDHYLPLPQNPAMVLMDTDLISKAPARFLISGIG
DAFATYYEAAACVQSSAITMTGGHATNAAFALATLCHDNLLADGVKAVSAVKAGLRTKAV
ENIIETNTLLSGLGFESCGLAAAHSIHDGLTALPETHSYLHGEKVAFGTLAQMIMEDRSL
DELTEVYRFFRAVGLPTNFKGIGITDVSDQQLLQVGELACGPNDTMANMPFAVEPIDVAH
ALRAADALDSVIKD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacagttttatgctcacccggaacatatgttcagcaggagggggccatcaaaact
ctggctgctgagtatgcagccgtcagtccatctgaaggcaggaacggggcttatatcatc
gtggattcggtaattgatggactctatcatgatgatattgtgtccagttttacttccggg
tcagatgacggtcaagccacgcatgtcaagtataagctggttctttttggcggtgagtgc
tctgatgctgagattcagaagcatgtagcacagctggaagatgcggatacggtcatcgga
attggcggcggcaaaacgctggacactgcaaaagctgttggttactacggcaagcgtcag
gcaataatcgttcccacggctgcttccagcgatgccccttgctcccggttgtctgttgtc
tatacagatgacagtcagtttgatcactaccttccgctgccgcagaatccggcgatggtg
ctgatggatacagatttaatttccaaggcaccagcccgctttctcatttctggcattggt
gatgcttttgcgacctactatgaggctgcggcttgtgttcaatccagcgctattacgatg
accggcggtcacgcgaccaatgctgcttttgcgctggctaccctctgccacgataatctt
ctggcagatggagtcaaggctgtgtctgcagtaaaagcaggcctgaggactaaggcagtc
gaaaacattatcgagaccaatactttgctctcgggtttgggctttgagtcctgcggcctt
gcggcagcacactcgattcacgatggtcttactgctcttccggaaacacactcttacctg
catggagaaaaagtcgcctttgggaccttggcacaaatgatcatggaagatcgatccctg
gatgaattaacagaagtctaccgcttcttccgtgcagttggtctgccaactaacttcaaa
ggcattggtattacagatgtttccgatcagcagctcctgcaggtcggagagcttgcttgc
ggtcctaacgataccatggctaatatgcccttcgcagttgaaccgattgatgttgctcat
gctctccgtgcggctgacgctcttgattctgtgattaaggattaa

DBGET integrated database retrieval system