KEGG   Scardovia inopinata: SCIP_1237Help
Entry
SCIP_1237         CDS       T03977                                 

Definition
(GenBank) transcriptional activator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
sij  Scardovia inopinata
Pathway
sij00730  Thiamine metabolism
sij01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sij00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SCIP_1237
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sij03000]
    SCIP_1237
Enzymes [BR:sij01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     SCIP_1237
Transcription factors [BR:sij03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SCIP_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: BAR07304
Position
1547521..1548201
Genome map
AA seq 226 aa AA seqDB search
MNDSKTTKFSEKLHQAAAPLWQKSIHHPFITELASGKLPLATFRYYLTQDTKYLTAFEKL
HEKTAALLPQSQGALLLKLANGSGEDVQRSPMLQQLKLSPAEIQQAPIAPNNYAYITHME
YQLNVDPAAAVTALLPCYWLYDEIADYWKDQTSPVPVYQAFFDSYQTVGFDTSTQQLIGL
VNELAANSNETVKQQMMTAFLRSSSYELGFWQMAYTHQTWADLANN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactcaaaaaccactaaattttctgaaaaactgcatcaagcagctgcaccactc
tggcaaaaaagcattcaccatccatttatcactgaactggccagcggtaaactgccattg
gcaacctttcgctattatctgacgcaggataccaaatacctgaccgcgtttgaaaagctg
cacgaaaaaactgccgccctgcttcctcaatcacagggcgcgctgctcttaaagctggcc
aacggttccggggaagacgttcagcgcagtcctatgctgcaacagctcaagctcagtcca
gcagagattcagcaagctcccatcgctcctaacaactacgcttacatcacccatatggag
tatcagctgaacgttgatcccgctgccgccgtgaccgctcttttaccctgctactggctt
tatgatgagattgccgactactggaaagatcagaccagtcccgttcccgtctaccaagca
ttttttgacagctatcagacagtcggttttgataccagtacccaacagctgatcggcttg
gtcaatgaactggccgccaacagcaatgaaaccgtcaaacaacagatgatgacggccttt
ttgcgcagcagcagctatgagctgggcttttggcaaatggcttatactcaccagacctgg
gctgacctggctaataattaa

DBGET integrated database retrieval system