KEGG   Streptococcus iniae SF1: K710_0565Help
Entry
K710_0565         CDS       T02686                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sik  Streptococcus iniae SF1
Pathway
sik00471  D-Glutamine and D-glutamate metabolism
sik00550  Peptidoglycan biosynthesis
sik01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sik00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    K710_0565
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    K710_0565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sik01011]
    K710_0565
Enzymes [BR:sik01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     K710_0565
Peptidoglycan biosynthesis and degradation proteins [BR:sik01011]
 Precursor biosynthesis
  Amino acid ligase
   K710_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C AlaDh_PNT_C DUF364
Motif
Other DBs
NCBI-ProteinID: AGM98344
Position
535254..536612
Genome map
AA seq 452 aa AA seqDB search
MKKITNFKNKKVLVLGLAKSGQAAARLLNQLGAMVTVNDGKTFEENPEAQSLLAEGIKVI
CGSHPLTLLDENFEVVIKNPGIPYRNPMVKKALDKEIPILTEVELAYLVSEAPIIAITGS
NGKTTTTTMIADILKHGGQSALLSGNIGFPASEVAIAAESSDTLVMELSSFQLMGVQAFH
PHIALITNLMPSHLDYHGTFQEYVAAKWNVQNNMTPEDFVILNANQAISKELAQNTRAQV
IYFSTTEKINGAYLFEGKLYYQGDYIMDADQIGVPGSHNIENALAAISVAKLSGLSNQVI
AESISRFSGVKHRLQFVGAIDGVRFYNDSKSTNILACQKALSGFANEHLILIAGGLDRGN
EFDELVPDIVGLKKMIVLGESAEKMKAAAEKAGVTCLKAKDVADATRMAKEVAQAGDTIL
LSPANASWDMYKNFEIRGEEFLSAYRDLKGDA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattacaaattttaaaaataagaaagttcttgttctgggtttagctaaatca
ggacaggcagcagcacgccttttaaaccagttgggggctatggtcactgttaatgatggc
aaaacttttgaagaaaatccagaggctcagtccttattggctgaagggatcaaagttatc
tgtggaagtcatcctctaacacttttggatgaaaattttgaagtcgtgattaaaaatcca
gggattccctatcgtaatcctatggtaaaaaaagctttagacaaagagattccaattctg
accgaagttgaattggcttatttggtttctgaggctccaatcattgctatcacaggttca
aacggaaaaacaaccacaacaacaatgattgctgacattttaaaacatggcggacaatca
gcactcttatcagggaatattggttttccagcttcggaagttgctattgcagcagagtca
tcagacacccttgtaatggagttatcatcgtttcaattgatgggagtgcaagctttccat
ccacacattgccttgattacaaacctaatgccaagtcatttggactatcatggcactttc
caggagtatgtagcagcaaaatggaatgtccaaaacaacatgaccccagaagattttgtg
attttgaatgccaaccaagccatatcaaaagagttagctcaaaacactagagcgcaagtt
atttacttttcaactactgaaaaaatcaatggtgcttatctttttgaaggcaaactctat
taccaaggggactatataatggatgctgatcaaattggtgtcccgggcagccataatatt
gaaaatgctcttgcagctattagcgttgcaaaattatcaggcctatcaaatcaagtcatt
gcagaaagtatttcacgttttagtggggttaaacatcgcctccaatttgtcggcgctatt
gatggcgtgcgcttttacaatgatagcaaatcaaccaacattttagcttgtcaaaaagct
ttatcgggctttgctaatgagcatttgattttgattgccggtggtttagaccgagggaat
gaatttgatgaattagtacctgacattgtaggactgaaaaaaatgattgtcctaggagag
tcagctgaaaaaatgaaagcggcagctgaaaaagctggcgtaacttgtcttaaggctaaa
gatgtagcagatgcaactcgcatggctaaagaagttgcccaagcaggagataccatttta
cttagtccagccaatgccagttgggatatgtataagaactttgaaatccgtggagaagaa
tttctgtcagcttaccgtgacttaaaaggagatgcctaa

DBGET integrated database retrieval system