KEGG   Streptococcus iniae SF1: K710_1514Help
Entry
K710_1514         CDS       T02686                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sik  Streptococcus iniae SF1
Pathway
sik00450  Selenocompound metabolism
sik00970  Aminoacyl-tRNA biosynthesis
sik01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sik00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    K710_1514
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    K710_1514
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sik01007]
    K710_1514
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sik03016]
    K710_1514
Enzymes [BR:sik01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     K710_1514
Amino acid related enzymes [BR:sik01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   K710_1514
Transfer RNA biogenesis [BR:sik03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    K710_1514
 Prokaryotic type
   Other AARSs
    K710_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 DUF3051
Motif
Other DBs
NCBI-ProteinID: AGM99273
Position
complement(1459555..1461558)
Genome map
AA seq 667 aa AA seqDB search
MTDKKPFYITTPIYYPSGKLHIGSAYTTIACDVIARYKRMMNHEVFYLTGLDEHGQKIQS
KAEEAGITPQAYVDGMAKEVKELWSLLDISYDHFIRTTDAYHEEVVAAVFEKLLAQDDIY
LGEYSGWYSVSDEEFFTESQLEEVFRDASGNVIGGIAPSGHQVEWVSEESYFLRLSKYAD
RLVAFFNQHPDFIQPDGRMNEMMKNFIEPGLEDLAVSRTTFTWGVSVPSNPKHVVYVWID
ALLNYATALGYGQENHDNYDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDMKLPERLIA
HGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINY
ELANDLGNLLNRTIAMVNKYFDGQIPSYVANVTAFDADLAQVVAEQITDYHNYMEAVDYP
RALEAVWTIISRANKYIDETAPWLLAKEDGDKEHLASVMAHLAASLRVVAHLIQPFMMTT
SNAIMEQLGLSLDFDLENLELSGLPTGVTVIAKGQPIFPRLDMEEEISYIKSEMEGNSPN
TAEKEWVPEDVKLTSSKEEIKFETFDAVEIRVAEVKEVSKVEGSDKLLCFRLDAGDGEDR
QILSGIAKFYPNEQELVGKKLQIVANLKPRKMMKKYISQGMILSAEHDGKLTVLTVDPSV
ANGSIIG
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgacagataaaaaaccattttacattacaacaccaatttattacccatcaggtaaatta
cacattggctcagcctacacaaccattgcttgtgatgttattgcccgctataaacgcatg
atgaaccatgaggttttctaccttactggtcttgatgaacatggtcaaaaaattcaaagt
aaggctgaagaagctggtattactccgcaagcttatgttgatggaatggcaaaagaggtt
aaggaactttggtcattgctagacatctcttatgaccattttatccgtacaacagacgct
taccatgaagaagtggttgcagctgtttttgagaaattactggctcaagatgatatttat
ttaggagaatattcaggatggtattcggtatctgatgaggaattctttacagaaagtcaa
cttgaagaagttttccgtgatgcttcaggaaatgttattggtgggattgcaccatcagga
catcaagtagaatgggtttcagaagaatcttatttcttacgccttagcaaatatgcggat
cgtttggttgcattttttaatcaacatccagacttcatccaaccagatgggcgtatgaat
gaaatgatgaagaatttcattgagcctgggttagaagatttagcagtttcaaggaccacc
tttacatggggtgtttcagtaccgtcaaaccctaaacacgtggtttatgtgtggattgat
gctctcttaaactatgcaacagcattaggttatggtcaagaaaatcatgacaactacgat
aaattctggaatggaacagttttccacatggttggtaaagatattctacgtttccactcg
atatactggccaattcttttaatgatgctagacatgaaactgccagaacgtctgattgct
catggctggtttgtcatgaaagatggcaaaatgtccaaatcaaaaggcaatgtggtttac
ccagaaatgttggtagaacgttttggtcttgatccactacgttattacctcatgcgttct
cttccagttggttcagatggtacttttacccctgaagactatgttggtcgtatcaactat
gaacttgccaatgatttaggaaacctacttaaccgtaccattgctatggtgaacaagtat
tttgatgggcaaattccttcctatgttgccaatgtaactgcttttgatgctgatttagct
caagtagtagcagagcaaattacagattatcataactatatggaagctgttgattatcca
cgtgccttagaggctgtttggacaattatttctcgtgccaataaatacattgatgaaaca
gctccatggcttttagctaaagaagacggtgataaagaacacttggcctctgtaatggct
cacttagcagcaagcttgcgcgtggttgctcatttgatccaaccttttatgatgacaact
tcaaatgctattatggaacaacttggtttatcccttgattttgaccttgaaaaccttgaa
ctttcaggtttgccaactggtgttactgtgattgcaaaagggcaacccatcttcccaaga
cttgatatggaagaagaaattagctatatcaaatctgaaatggaaggaaactcacctaat
acagcagaaaaagagtgggttccagaggacgttaaattgacttcttcaaaagaagaaatt
aaatttgaaacctttgatgctgttgagattcgagttgctgaagttaaggaagtttcaaaa
gtagaagggtctgataaattattgtgtttccgtttagatgctggtgacggtgaagatcgt
caaatcctatcaggaattgcaaaattctatcctaatgaacaagaattagtgggtaaaaaa
ttacaaattgtagctaacttaaaaccacgtaaaatgatgaaaaaatacattagccaaggt
atgattttatctgctgaacacgatggaaagctaaccgttttaactgttgatccatcagta
gcaaatggttctattattggttag

DBGET integrated database retrieval system