KEGG   Streptococcus iniae SF1: K710_1768Help
Entry
K710_1768         CDS       T02686                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sik  Streptococcus iniae SF1
Pathway
sik00970  Aminoacyl-tRNA biosynthesis
sik01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sik00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    K710_1768
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sik03029]
    K710_1768
Enzymes [BR:sik01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     K710_1768
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     K710_1768
Mitochondrial biogenesis [BR:sik03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    K710_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGM99518
Position
complement(1700498..1701937)
Genome map
AA seq 479 aa AA seqDB search
MNFETIIGLEVHVELNTNSKIFSPSPAHFGQEANASTNIIDWSFPGVLPVINKGVIDSGI
KAALALNMSIHKEMHFDRKNYFYPDNPKAYQISQFDEPIGYDGWIDITLEDGSKKKIRIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEIIQYTG
ISDVKMEEGSMRVDANISLRPYGQEEFGTKTELKNLNSFSNVRKGLEFEVERQAKVLRSG
GIIRQETRRYDEANKGTILMRVKEGAADYRYFPEPDLPLYDIDDAWIEEMRTELPKFPAE
RRETYVETLGLSDYDANQLTATKALSDFFEKTVDLGGDPKQVSNWLQGEVAQFLNAENKT
IEAIQLTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGSARDYVEKAGLVQISDPEVL
IPIIHQVFADNEAAVADFTSGKRNADKAFTGFLMKATKGQANPQVAQQLLAQELQKLLD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacaattattggtcttgaagtccatgtggaattaaacactaattctaaa
attttctcaccttcaccagcacactttggtcaagaagctaatgctagtaccaatattatt
gattggtcatttcctggtgttcttcctgtcattaacaagggagttattgattcagggatt
aaagcagcacttgctttaaatatgtctattcataaagaaatgcactttgaccgtaagaat
tatttctaccctgataaccctaaggcttaccaaatttcacagtttgatgaacctatcggt
tatgatggctggattgacattaccttagaagatggcagtaagaagaaaatccgtatcgag
cgtgcgcatttggaagaagatgcaggtaaaaatacacatgggacagacggctactcatac
gttgatttaaaccgtcaaggtgttccattgattgagattgtttctgaagcagacatgcgt
tctcctgaggaagcttatgcttacttaacagccttgaaagaaatcatccaatatacaggt
atttctgatgttaagatggaagaaggctcaatgcgtgtggatgccaatatctcacttcgc
ccatatggtcaagaggaatttggaaccaaaacggaattgaaaaatctgaactcttttagt
aatgtacgtaagggacttgaatttgaagttgaacgtcaagctaaagtgcttcgttctggt
ggtattatccgtcaagaaacaagacgttacgacgaagctaataaagggacgattttaatg
cgtgtaaaagaaggcgctgctgactaccgttatttcccagaaccagaccttcctttgtat
gacattgatgacgcatggattgaagaaatgcgtacagaattgccaaaattcccagcagag
cgtcgtgaaacatatgttgagactcttggtctttctgactatgatgccaaccaattaacg
gctaccaaagccttatcagatttctttgagaaaactgtagatttaggaggagatcctaaa
caagtctctaactggttgcaaggtgaagtggcccaattcttaaatgcagaaaataaaacc
attgaagctattcaattaacaccagaaaacttagttgaaatgattgccattatcgaagat
ggaacaatttcttctaagattgctaagaaagtctttgttcacttggctaaaaatggtggt
tcagctagagactatgtggaaaaagcaggtttggttcaaatttctgatccagaggttttg
attccaattattcatcaagttttcgcagataatgaggcagctgttgctgactttacatct
ggtaaacgtaatgcggacaaagcctttacaggattcttaatgaaagcaaccaaaggccaa
gccaacccacaagttgcacaacaattattggctcaagaattgcaaaaactcttggactga

DBGET integrated database retrieval system