KEGG   Ruegeria pomeroyi: SPO0130Help
Entry
SPO0130           CDS       T00215                                 

Definition
(GenBank) cytochrome c family protein
  KO
K08738  cytochrome c
Organism
sil  Ruegeria pomeroyi
Pathway
sil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sil00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPO0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C NifZ Ntox44
Motif
Other DBs
NCBI-ProteinID: AAV93458
UniProt: Q5LWT7
Position
137081..137494
Genome map
AA seq 137 aa AA seqDB search
MNRFVAAAFACVLAVPALAEGDAAKGEKGFNKCKSCHMIESPAGETIVKGGKTGPNLYGV
VGRAAGTYEGYKYGDSLVAAGEKGLVWDEESFVAFTQDPKSFLNTYLGETAAKSKMTFKL
KSGGEDVFAYLQSVAAE
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgatttgtcgccgccgcctttgcctgcgttcttgccgttcccgccctcgccgag
ggtgacgccgccaagggtgagaagggtttcaacaagtgcaagtcctgccacatgatcgag
agccccgcgggcgagaccatcgtcaagggcggcaagaccgggccgaacctgtatggcgtc
gtgggccgggccgccggcacctatgaagggtacaaatacggtgacagcctggttgctgcc
ggcgaaaagggtctggtctgggacgaagagagctttgtcgccttcacccaggaccccaaa
agcttcctgaacacctatctgggtgaaacggcggccaagtcgaaaatgaccttcaagctt
aaatcgggtggcgaggacgtgttcgcctatctgcaaagcgtcgccgccgaataa

DBGET integrated database retrieval system