KEGG   Ruegeria pomeroyi: SPO0946Help
Entry
SPO0946           CDS       T00215                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sil  Ruegeria pomeroyi
Pathway
sil00010  Glycolysis / Gluconeogenesis
sil00030  Pentose phosphate pathway
sil00051  Fructose and mannose metabolism
sil00052  Galactose metabolism
sil00230  Purine metabolism
sil00500  Starch and sucrose metabolism
sil00520  Amino sugar and nucleotide sugar metabolism
sil00521  Streptomycin biosynthesis
sil01100  Metabolic pathways
sil01110  Biosynthesis of secondary metabolites
sil01120  Microbial metabolism in diverse environments
sil01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPO0946 (algC)
   00030 Pentose phosphate pathway
    SPO0946 (algC)
   00051 Fructose and mannose metabolism
    SPO0946 (algC)
   00052 Galactose metabolism
    SPO0946 (algC)
   00500 Starch and sucrose metabolism
    SPO0946 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    SPO0946 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    SPO0946 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPO0946 (algC)
Enzymes [BR:sil01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SPO0946 (algC)
    5.4.2.8  phosphomannomutase
     SPO0946 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAV94251
UniProt: Q5LUV6
Position
complement(996821..998317)
Genome map
AA seq 498 aa AA seqDB search
MTKPLSEVTPNTWTFLRDAMIRPTGFREYDARWKYPEEINLPGMTALGLGLGTQMHRRGI
APVIAVGNDYRDYSLAIKNALILGLMQAGIQVKDIGPALSPMAYFSQFHLDVPAVAMVTA
SHNPNGWTGVKMGFDRPLTHGPDEMAELRDIVLNGEGVARPGGSYEFVDGVKEAYIDDLV
GDFRMSRPLKVVCATGNGTASAFAPEIFARMGVEIVPSHNELDYTFPNYNPNPEAMEMLH
DMADTVKASGADFALGFDGDGDRCGVVDDEGEEIFADKVGVIMARDLSKLYPGSTFVADV
KSTGLFAADPELQKHGAKADYWKTGHSHMKRRVKEIGALAGFEKSGHYFLAEPIGRGYDC
GMRVAVEICKLMDRNPEMSMSDLRKALPRTWSTPTMSPYAADTEKYAILERLVEKLVAKH
AAGDSFAGRAIKEVVTVNGARVILDNGSWGLVRASSNTPNLVVVCESSESEAEMRAIFAE
IDEVIRTEPGVGDYDQTI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcccctttccgaggtgactccaaacacctggaccttcctgcgcgatgccatg
atccggccaaccggatttcgcgaatacgatgcccgctggaagtatcccgaagagatcaac
ctgcccggcatgactgcgctgggcctgggtctgggcacccagatgcaccgccgtggcatc
gcgccggtgatcgcggtcggcaacgattatcgcgactattcgctggccatcaagaacgcg
ctgatcctgggcctgatgcaggccggcatccaggtcaaggatatcggccccgccctgtcg
ccgatggcctatttctcgcagttccatctggatgtgcccgccgtggcgatggtgaccgcc
agccacaacccgaacggctggaccggggtcaagatgggctttgaccggccgctgacccat
ggacccgacgagatggccgagctgcgcgacatcgtgctgaacggcgagggcgtggcgcgc
ccgggcggctcttacgaattcgtggacggcgtgaaagaggcctatatcgacgatctggtc
ggcgatttccgcatgtcgcgcccgctcaaggtggtctgcgccaccggcaacggcaccgcc
tcggcctttgcgcccgaaatctttgcccgcatgggcgtcgagatcgtgccgagccacaat
gagctcgactacacctttcccaactacaaccccaaccccgaagccatggaaatgctgcat
gacatggccgacacggtcaaagccagcggcgccgatttcgcgctgggctttgacggcgat
ggcgaccgctgcggcgtggtggatgacgagggcgaggagatttttgccgacaaggtgggc
gtgatcatggcgcgcgacctctcgaaactctatcccgggtccacctttgtagcggatgtg
aaatccaccggcctgtttgccgccgatcccgagttgcagaaacacggcgccaaggccgat
tactggaagaccggccacagccacatgaaacgcagggtcaaggagatcggcgcactggcg
gggttcgagaaatccggtcactactttctggccgagccgatcgggcgcggctatgactgc
ggcatgcgggtggcggtcgagatctgcaagctgatggatcgcaaccccgaaatgtcgatg
tcggacctgcgcaaggcgctgccgcgcacctggtcgacgcccaccatgtcgccctatgct
gccgacaccgagaaatacgccattctggagcggctggtggaaaagctggttgccaaacat
gccgccggtgacagctttgccgggcgtgccatcaaggaggtggtcaccgtgaacggtgcc
cgtgtcatcctggacaacggctcctgggggctggtgcgcgcctcgtcgaacacgcccaac
ctggtggtggtctgcgaaagcagcgagagcgaggcggagatgcgcgccatctttgccgag
atcgacgaggttatccgcaccgagccgggcgtgggcgactacgaccagaccatctga

DBGET integrated database retrieval system