KEGG   Ruegeria pomeroyi: SPO1000Help
Entry
SPO1000           CDS       T00215                                 

Gene name
soxE
Definition
(GenBank) diheme cytochrome c SoxE
  KO
K08738  cytochrome c
Organism
sil  Ruegeria pomeroyi
Pathway
sil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sil00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPO1000 (soxE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AAV94304
UniProt: Q5LUQ3
Position
1052038..1052748
Genome map
AA seq 236 aa AA seqDB search
MRWLGGAILAGAALTGVARADETARDIGDAARGEELFQVCASCHQVGEGAEHGTGPHLNG
IFDRKVAQFEDFDYSPGILRARRDGMVWDLEHLDAYLTNPKTLVSGTNMDFAGLPDPQDR
GDILAYLRRFSASPQNIPEAAPTALKQDVELAPEVLAMVGDPEYGEYLSTECTTCHQVDG
EYDGIPVITGWLAEDFVLAMHAYKLKIRPHPVMQMMAGRLSDEEIAALAAYFEALE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggctgggaggagcgatactggccggggccgccctgacgggggtggcccgggcc
gacgagaccgcgcgtgacatcggcgatgccgcgcgcggggaggagctgtttcaggtctgt
gccagctgtcaccaggtgggcgagggggccgagcacggcaccgggccgcatctgaacggc
atcttcgatcgcaaggtcgcccagttcgaggatttcgactattccccgggcatcctgcgc
gcccggcgcgacgggatggtctgggatctcgaacatctcgatgcctatctgaccaatccc
aagaccctggtctcgggcaccaacatggacttcgcgggcctgcctgatccgcaggaccgc
ggcgacatcctggcctatctgcgccggttctcggccagtccccagaacatccccgaggcg
gcgcccactgctctgaaacaggatgtggaactggcacccgaagtgctggccatggtgggc
gatcccgaatatggtgaatacctgtccaccgaatgcaccacctgccatcaggtcgatggc
gagtatgacggcattccggtgatcaccggctggctggccgaggatttcgtccttgccatg
catgcctacaaactgaagatcaggccacacccggtgatgcagatgatggccgggcggctg
tcggacgaggagatcgcggccctggcggcctatttcgaagcgctggagtaa

DBGET integrated database retrieval system